Zu "GeneID 201134" wurden 9 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-CEP112 / CCDC46
Artikelnummer: ARG55071.100
| Schlagworte: | Anti-CEP112, Anti-Cep112, Anti-CCDC46, Anti-Centrosomal protein of 112 kDa, Anti-Coiled-coil domain-containing protein 46 |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
616,00 €
Anti-CEP112
Artikelnummer: ATA-HPA024481.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 82% and to rat: 77%
| Schlagworte: | Anti-Cep112, Anti-CEP112, Anti-CCDC46, Anti-Centrosomal protein of 112 kDa, Anti-Coiled-coil domain-containing protein 46 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
Anti-CEP112
Artikelnummer: ATA-HPA069724.100
Polyclonal Antibody against Human CEP112, Gene description: centrosomal protein 112, Alternative Gene Names: CCDC46, MGC33887, Validated applications: ICC, Uniprot ID: Q8N8E3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 100% Rat gene identity: 100%
| Schlagworte: | Anti-CCDC46, Anti-CEP112, Anti-Cep112, Anti-Centrosomal protein of 112 kDa, Anti-Coiled-coil domain-containing protein 46 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
CEP112 (human), recombinant protein
Artikelnummer: ABS-PP-8008-L.100
| Schlagworte: | Centrosomal protein of 112 kDa, Cep112, Coiled-coil domain-containing protein 46, Recombinant Human CEP112 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 15 kD |
ab 115,00 €
Anti-CCDC46, NT (CEP112, CCDC46, Centrosomal protein of...
Artikelnummer: 033326.200
CCDC46 is a protein with filament, myosin tail and ATPase domains. Orthologs of this gene exist in mouse, rat and chimp. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000,...
| Schlagworte: | Anti-CCDC46, Anti-CEP112, Anti-Centrosomal protein of 112 kDa, Anti-Coiled-coil domain-containing protein 46 |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
865,00 €
CEP112 PrEST Antigen
Artikelnummer: ATA-APrEST75738.100
Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | Cep112, CEP112, CCDC46, Centrosomal protein of 112 kDa, Coiled-coil domain-containing protein 46 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Anti-CE112
Artikelnummer: ELK-ES17530.100
This gene encodes a coiled-coil domain containing protein that belongs to the cell division control protein 42 effector protein family. In neurons, it localizes to the cytoplasm of dendrites and is also enriched in the nucleus where it interacts with the RNA polymerase III transcriptional repressor Maf1 to regulate...
| Schlagworte: | Anti-Cep112, Anti-CEP112, Anti-CCDC46, Anti-Centrosomal protein of 112 kDa, Anti-Coiled-coil domain-containing protein 46,... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 173,00 €
CEP112 (human), recombinant protein
Artikelnummer: ABS-PP-8008.100
| Schlagworte: | Centrosomal protein of 112 kDa, Cep112, Coiled-coil domain-containing protein 46, Recombinant Human CEP112 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 15 kD |
ab 90,00 €
CEP112 PrEST Antigen
Artikelnummer: ATA-APrEST96046.100
PrEST Antigen CEP112, Gene description: centrosomal protein 112, Alternative Gene Names: CCDC46, MGC33887, Antigen sequence: LMPASLRQELEDTISSLKSQVNFLQKRASILQEELTTY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 100% Rat gene identity: 100%
| Schlagworte: | CCDC46, Cep112, CEP112, Centrosomal protein of 112 kDa, Coiled-coil domain-containing protein 46 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €