Zu "GeneID 201134" wurden 10 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
Anti-CEP112 / CCDC46
Anti-CEP112 / CCDC46

Artikelnummer: ARG55071.100

Schlagworte: Anti-CEP112, Anti-Cep112, Anti-CCDC46, Anti-Centrosomal protein of 112 kDa, Anti-Coiled-coil domain-containing protein 46
Anwendung: WB
Wirt: Rabbit
Spezies-Reaktivität: human
616,00 €
Bewerten
Anti-CEP112
Anti-CEP112

Artikelnummer: ATA-HPA024481.100

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 82% and to rat: 77%
Schlagworte: Anti-Cep112, Anti-CEP112, Anti-CCDC46, Anti-Centrosomal protein of 112 kDa, Anti-Coiled-coil domain-containing protein 46
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 369,00 €
Bewerten
Anti-CEP112
Anti-CEP112

Artikelnummer: ATA-HPA069724.100

Polyclonal Antibody against Human CEP112, Gene description: centrosomal protein 112, Alternative Gene Names: CCDC46, MGC33887, Validated applications: ICC, Uniprot ID: Q8N8E3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 100% Rat gene identity: 100%
Schlagworte: Anti-CCDC46, Anti-CEP112, Anti-Cep112, Anti-Centrosomal protein of 112 kDa, Anti-Coiled-coil domain-containing protein 46
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
491,00 €
Bewerten
NEU
Anti-CEP112
Anti-CEP112

Artikelnummer: ATA-HPA069724.25

Polyclonal Antibody against Human CEP112, Gene description: centrosomal protein 112, Alternative Gene Names: CCDC46, MGC33887, Validated applications: ICC, Uniprot ID: Q8N8E3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 100% Rat gene identity: 100%
Schlagworte: Anti-CCDC46, Anti-CEP112, Anti-Cep112, Anti-Centrosomal protein of 112 kDa, Anti-Coiled-coil domain-containing protein 46
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
361,00 €
Bewerten
CEP112 (human), recombinant protein
CEP112 (human), recombinant protein

Artikelnummer: ABS-PP-8008-L.100

Schlagworte: Centrosomal protein of 112 kDa, Cep112, Coiled-coil domain-containing protein 46, Recombinant Human CEP112 Protein
Exprimiert in: E.coli
Ursprungsart: human
MW: 15 kD
ab 115,00 €
Bewerten
Anti-CCDC46, NT (CEP112, CCDC46, Centrosomal protein of 112kD, Coiled-coil domain-containing protein
Anti-CCDC46, NT (CEP112, CCDC46, Centrosomal protein of...

Artikelnummer: 033326.200

CCDC46 is a protein with filament, myosin tail and ATPase domains. Orthologs of this gene exist in mouse, rat and chimp. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000,...
Schlagworte: Anti-CCDC46, Anti-CEP112, Anti-Centrosomal protein of 112 kDa, Anti-Coiled-coil domain-containing protein 46
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: human
865,00 €
Bewerten
CEP112 PrEST Antigen
CEP112 PrEST Antigen

Artikelnummer: ATA-APrEST75738.100

Buffer: PBS and 1M Urea, pH 7.4.
Schlagworte: Cep112, CEP112, CCDC46, Centrosomal protein of 112 kDa, Coiled-coil domain-containing protein 46
Anwendung: Control antigen
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
Anti-CE112
Anti-CE112

Artikelnummer: ELK-ES17530.100

This gene encodes a coiled-coil domain containing protein that belongs to the cell division control protein 42 effector protein family. In neurons, it localizes to the cytoplasm of dendrites and is also enriched in the nucleus where it interacts with the RNA polymerase III transcriptional repressor Maf1 to regulate...
Schlagworte: Anti-Cep112, Anti-CEP112, Anti-CCDC46, Anti-Centrosomal protein of 112 kDa, Anti-Coiled-coil domain-containing protein 46,...
Anwendung: WB
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
ab 173,00 €
Bewerten
CEP112 (human), recombinant protein
CEP112 (human), recombinant protein

Artikelnummer: ABS-PP-8008.100

Schlagworte: Centrosomal protein of 112 kDa, Cep112, Coiled-coil domain-containing protein 46, Recombinant Human CEP112 Protein
Exprimiert in: E.coli
Ursprungsart: human
MW: 15 kD
ab 90,00 €
Bewerten
CEP112 PrEST Antigen
CEP112 PrEST Antigen

Artikelnummer: ATA-APrEST96046.100

PrEST Antigen CEP112, Gene description: centrosomal protein 112, Alternative Gene Names: CCDC46, MGC33887, Antigen sequence: LMPASLRQELEDTISSLKSQVNFLQKRASILQEELTTY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 100% Rat gene identity: 100%
Schlagworte: CCDC46, Cep112, CEP112, Centrosomal protein of 112 kDa, Coiled-coil domain-containing protein 46
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten