- Suchergebnis für GeneID 200350
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 200350" wurden 12 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: G-PACO02639.50
FOXD4L1 Antibody from Assay Genie with reactivity against Human and for use in ELISA, WB applications. FOXD4L1 Antibody is Polyclonal and is a IgG isotype antibody from Assay Genie.
| Schlagworte: | Anti-FOXD4L1, Anti-FOXD4-like 1, Anti-Forkhead box protein D4-like 1 |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
225,00 €
Artikelnummer: CSB-PA008024.50
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Schlagworte: | Anti-FOXD4L1, Anti-FOXD4-like 1, Anti-Forkhead box protein D4-like 1, bA395L14.1 antibody, Forkhead box D4 like 1... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
126,00 €
Artikelnummer: ATA-HPA069839.100
Polyclonal Antibody against Human FOXD4L1, Gene description: forkhead box D4 like 1, Alternative Gene Names: FOXD5, Validated applications: ICC, Uniprot ID: Q9NU39, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 56% Rat gene identity: 56%
| Schlagworte: | Anti-FOXD4L1, Anti-FOXD4-like 1, Anti-Forkhead box protein D4-like 1 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
NEU
Artikelnummer: ATA-HPA069839.25
Polyclonal Antibody against Human FOXD4L1, Gene description: forkhead box D4 like 1, Alternative Gene Names: FOXD5, Validated applications: ICC, Uniprot ID: Q9NU39, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 56% Rat gene identity: 56%
| Schlagworte: | Anti-FOXD4L1, Anti-FOXD4-like 1, Anti-Forkhead box protein D4-like 1 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
361,00 €
Artikelnummer: ABS-PP-2828-L.100
| Schlagworte: | Forkhead box protein D4-like 1, FOXD4-like 1, Recombinant Human FOXD4L1 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 31.5 kD |
ab 115,00 €
Artikelnummer: ABS-PP-2829-L.100
| Schlagworte: | Forkhead box protein D4-like 1, FOXD4-like 1, Recombinant Human FOXD4L1 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 12.5 kD |
ab 115,00 €
Artikelnummer: 600-401-BG2
Anti-FOXD4L1 Antibody was affinity purified from monospecific antiserum by immunoaffinity chromatography. This antibody is predicted to not cross-react with any FOXD4 protein family members
| Schlagworte: | Anti-FOXD4L1, Anti-FOXD4-like 1, Anti-Forkhead box protein D4-like 1 |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
848,00 €
Artikelnummer: 035808.200
This gene is a member of the forkhead/winged-helix (FOX) family of transcription factors with highly conserved FOX DNA-binding domains. Members of the FOX family of transcription factors are regulators of embryogenesis and may play a role in human cancer. This gene lies in a region of chromosome 2 that surrounds the...
| Schlagworte: | Anti-FOXD4L1, Anti-FOXD4-like 1, Anti-Forkhead box protein D4-like 1 |
| Anwendung: | ELISA, FC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
865,00 €
Artikelnummer: ELK-ES5100.100
forkhead box D4-like 1(FOXD4L1) Homo sapiens This gene is a member of the forkhead/winged-helix (FOX) family of transcription factors with highly conserved FOX DNA-binding domains. Members of the FOX family of transcription factors are regulators of embryogenesis and may play a role in human cancer. This gene lies...
| Schlagworte: | Anti-FOXD4L1, Anti-FOXD4-like 1, Anti-Forkhead box protein D4-like 1, FoxD4L1 rabbit pAb |
| Anwendung: | WB, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, rat, mouse, |
ab 173,00 €
Artikelnummer: ABS-PP-2828.100
| Schlagworte: | Forkhead box protein D4-like 1, FOXD4-like 1, Recombinant Human FOXD4L1 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 31.5 kD |
ab 90,00 €
Artikelnummer: ABS-PP-2829.100
| Schlagworte: | Forkhead box protein D4-like 1, FOXD4-like 1, Recombinant Human FOXD4L1 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 12.5 kD |
ab 90,00 €
Artikelnummer: ATA-APrEST96047.100
PrEST Antigen FOXD4L1, Gene description: forkhead box D4 like 1, Alternative Gene Names: FOXD5, Antigen sequence: GTLPVLQPSLGPQPWEEGKGLASPPGGGCISFSIESIMQGVRGAGTGAAQSLSPTAWSYCPLLQRPSSLSDN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 56% Rat gene identity: 56%
| Schlagworte: | FOXD4L1, FOXD4-like 1, Forkhead box protein D4-like 1 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €