Zu "GeneID 1783" wurden 10 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-DYNC1LI2
Artikelnummer: ATA-HPA057201.100
Protein function: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles...
| Schlagworte: | Anti-LIC-2, Anti-DNCLI2, Anti-LIC53/55, Anti-DYNC1LI2, Anti-Dynein light intermediate chain 2, cytosolic, Anti-Cytoplasmic... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Anti-DYNC1LI2
Artikelnummer: ATA-HPA049538.100
Polyclonal Antibody against Human DYNC1LI2, Gene description: dynein cytoplasmic 1 light intermediate chain 2, Alternative Gene Names: DNCLI2, Validated applications: IHC, WB, Uniprot ID: O43237, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Acts as one...
| Schlagworte: | Anti-LIC-2, Anti-DNCLI2, Anti-LIC53/55, Anti-DYNC1LI2, Anti-Dynein light intermediate chain 2, cytosolic, Anti-Cytoplasmic... |
| Anwendung: | IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
DYNC1LI2 (human), recombinant protein
Artikelnummer: ABS-PP-7532-L.100
Protein function: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles...
| Schlagworte: | Cytoplasmic dynein 1 light intermediate chain 2, Dynein light intermediate chain 2, cytosolic, LIC-2, LIC53/55,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 15.5 kD |
ab 115,00 €
DNCLI2, Human, Real Time PCR Primer Set
Artikelnummer: VHPS-2687
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | LIC-2, DNCLI2, DYNC1LI2, LIC53/55, Dynein light intermediate chain 2, cytosolic, Cytoplasmic dynein 1 light intermediate... |
| Anwendung: | RNA quantification |
45,00 €
Anti-DYNC1LI2, ID (DYNC1LI2, DNCLI2, LIC2, Cytoplasmic...
Artikelnummer: 034873.200
Cytoplasmic dynein is a microtubule-associated motor protein (Hughes et al., 1995 [PubMed 7738094]). See DYNC1H1 (MIM 600112) for general information about dyneins. Applications: Suitable for use in Western Blot, Immunohistochemistry, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500,...
| Schlagworte: | Anti-LIC-2, Anti-DNCLI2, Anti-DYNC1LI2, Anti-LIC53/55, Anti-Dynein light intermediate chain 2, cytosolic, Anti-Cytoplasmic... |
| Anwendung: | ELISA, IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
865,00 €
DYNC1LI2 PrEST Antigen
Artikelnummer: ATA-APrEST91790.100
Protein function: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles...
| Schlagworte: | LIC-2, DNCLI2, LIC53/55, DYNC1LI2, Dynein light intermediate chain 2, cytosolic, Cytoplasmic dynein 1 light intermediate... |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Anti-DYNC1LI2
Artikelnummer: G-CAB20592.20
Protein function: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles...
| Schlagworte: | Anti-LIC-2, Anti-DNCLI2, Anti-DYNC1LI2, Anti-LIC53/55, Anti-Dynein light intermediate chain 2, cytosolic, Anti-Cytoplasmic... |
| Anwendung: | WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
103,00 €
Anti-DYNC1LI2
Artikelnummer: CSB-PA007296GA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: DYNC1LI2. Antigen Species: Human
| Schlagworte: | Anti-LIC-2, Anti-DNCLI2, Anti-LIC53/55, Anti-DYNC1LI2, Anti-Dynein light intermediate chain 2, cytosolic, Anti-Cytoplasmic... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
552,00 €
DYNC1LI2 (human), recombinant protein
Artikelnummer: ABS-PP-7532.100
Protein function: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles...
| Schlagworte: | Cytoplasmic dynein 1 light intermediate chain 2, Dynein light intermediate chain 2, cytosolic, LIC-2, LIC53/55,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 15.5 kD |
ab 90,00 €
DYNC1LI2 PrEST Antigen
Artikelnummer: ATA-APrEST95624.100
PrEST Antigen DYNC1LI2, Gene description: dynein cytoplasmic 1 light intermediate chain 2, Alternative Gene Names: DNCLI2, Antigen sequence: PGSPGAGGVQSTAKKSGQKTVLSNVQEELDRMTRKPDSMVTNSSTE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Acts as one of several non-catalytic...
| Schlagworte: | LIC-2, DNCLI2, LIC53/55, DYNC1LI2, Dynein light intermediate chain 2, cytosolic, Cytoplasmic dynein 1 light intermediate... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €