Zu "GeneID 166863" wurden 11 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
NEU
RBM46 Protein, Human, Recombinant (His)
Artikelnummer: TGM-TMPH-04580-100ug
Description: RBM46 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q8TBY0.
| Schlagworte: | RNA-binding motif protein 46 , Probable RNA-binding protein 46 , RBM46 , Cancer/testis antigen 68 (CT68) |
| MW: | 66.9 kD |
ab 93,00 €
Anti-RBM46
Artikelnummer: ATA-HPA038431.100
Polyclonal Antibody against Human RBM46, Gene description: RNA binding motif protein 46, Alternative Gene Names: CT68, MGC27016, Validated applications: ICC, Uniprot ID: Q8TBY0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 90% Rat gene identity: 90%
| Schlagworte: | Anti-CT68, Anti-RBM46, Anti-Cancer/testis antigen 68, Anti-RNA-binding motif protein 46, Anti-Probable RNA-binding protein 46 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Anti-RBM46
Artikelnummer: ATA-HPA037746.100
Polyclonal Antibody against Human RBM46, Gene description: RNA binding motif protein 46, Alternative Gene Names: CT68, MGC27016, Validated applications: ICC, Uniprot ID: Q8TBY0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 100% Rat gene identity: 100%
| Schlagworte: | Anti-CT68, Anti-RBM46, Anti-Cancer/testis antigen 68, Anti-RNA-binding motif protein 46, Anti-Probable RNA-binding protein 46 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Probable RNA-binding protein 46 (RBM46), recombinant human
Artikelnummer: CSB-EP851536HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-533aa. Protein Length: Full Length. Tag Info: C-terminal 6xHis-tagged. Target Protein Sequence: MNEENIDGTN GCSKVRTGIQ NEAALLALME KTGYNMVQEN GQRKFGGPPP GWEGPPPPRG CEVFVGKIPR DMYEDELVPV FERAGKIYEF RLMMEFSGEN RGYAFVMYTT KEEAQLAIRI LNNYEIRPGK...
| Schlagworte: | CT68, RBM46, Cancer/testis antigen 68, RNA-binding motif protein 46, Probable RNA-binding protein 46 |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 66.9 kD |
ab 247,00 €
RBM46 (human), recombinant protein
Artikelnummer: ABS-PQ-3807-L.100
| Schlagworte: | CT68, RBM46, Cancer/testis antigen 68, RNA-binding motif protein 46, Probable RNA-binding protein 46 |
| Exprimiert in: | Human cells |
| Ursprungsart: | human |
| MW: | 64 kD |
ab 295,00 €
RBM46 (human), recombinant protein
Artikelnummer: ABS-PQ-3807.100
| Schlagworte: | CT68, RBM46, Cancer/testis antigen 68, RNA-binding motif protein 46, Probable RNA-binding protein 46 |
| Exprimiert in: | Human cells |
| Ursprungsart: | human |
| MW: | 64 kD |
ab 270,00 €
RBM46 PrEST Antigen
Artikelnummer: ATA-APrEST79790.100
Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | CT68, RBM46, Cancer/testis antigen 68, RNA-binding motif protein 46, Probable RNA-binding protein 46 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Anti-RBM46
Artikelnummer: ATA-HPA079488.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
| Schlagworte: | Anti-CT68, Anti-RBM46, Anti-Cancer/testis antigen 68, Anti-RNA-binding motif protein 46, Anti-Probable RNA-binding protein 46 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
Anti-RBM46
Artikelnummer: G-CAB16605.20
RBM46 Rabbit Polyclonal Antibody from Assay Genie with reactivity against Human, Mouse, Rat and for use in WB applications.RBM46 Rabbit Polyclonal Antibody is an IgG isotype antibody and produced in Rabbit and purified by Affinity purification from Assay Genie.
| Schlagworte: | Anti-CT68, Anti-RBM46, Anti-Cancer/testis antigen 68, Anti-RNA-binding motif protein 46, Anti-Probable RNA-binding protein 46 |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
103,00 €
RBM46 (Vector Vector will be determined during the...
Artikelnummer: CSB-CL851536HU.10
Length: 1602 Sequence: atgaatgaag aaaatataga tggaacaaat ggatgcagta aagttcgaac tggtattcag aatgaagcag cattacttgc tttgatggaa aagactggtt acaacatggt tcaggaaaat ggacaaagga aatttggcgg tcctcctcca ggttgggaag gtccacctcc acctagaggc tgtgaagttt ttgtaggaaa aatacctcgt gatatgtatg aagatgagtt agttcctgta tttgaaagag ctgggaagat...
| Schlagworte: | CT68, RBM46, Cancer/testis antigen 68, RNA-binding motif protein 46, Probable RNA-binding protein 46 |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
357,00 €
RBM46 PrEST Antigen
Artikelnummer: ATA-APrEST95630.100
PrEST Antigen RBM46, Gene description: RNA binding motif protein 46, Alternative Gene Names: CT68, MGC27016, Antigen sequence: QFTLLHLDYNFHRSSINSLSPVSATLSSGTPSVLPYTSRPYSYPGYPLSPTISLANGSHVGQRLCISNQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 90% Rat gene identity: 90%
| Schlagworte: | CT68, RBM46, Cancer/testis antigen 68, RNA-binding motif protein 46, Probable RNA-binding protein 46 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €