Zu "GeneID 165545" wurden 11 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-DQX1
Artikelnummer: ATA-HPA039158.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 76% and to rat: 76%
| Schlagworte: | Anti-DQX1, EC=3.6.4.12, Anti-DEAQ box polypeptide 1, Anti-ATP-dependent RNA helicase DQX1 |
| Anwendung: | ICC, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
Anti-DQX1
Artikelnummer: CSB-PA002190.100
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Schlagworte: | Anti-DQX1, EC=3.6.4.12, Anti-DEAQ box polypeptide 1, Anti-ATP-dependent RNA helicase DQX1, ATP dependent RNA helicase DQX1... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, monkey |
ab 126,00 €
Anti-DQX1
Artikelnummer: CSB-PA906253.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
| Schlagworte: | Anti-DQX1, EC=3.6.4.12, Anti-DEAQ box polypeptide 1, Anti-ATP-dependent RNA helicase DQX1, ATP dependent RNA helicase DQX1... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
284,00 €
Anti-DQX1
Artikelnummer: ATA-HPA046763.100
Polyclonal Antibody against Human DQX1, Gene description: DEAQ-box RNA dependent ATPase 1, Alternative Gene Names: FLJ23757, Validated applications: ICC, Uniprot ID: Q8TE96, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 85% Rat gene identity: 85%
| Schlagworte: | Anti-DQX1, EC=3.6.4.12, Anti-DEAQ box polypeptide 1, Anti-ATP-dependent RNA helicase DQX1 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Anti-DQX1
Artikelnummer: ATA-HPA046763.25
Polyclonal Antibody against Human DQX1, Gene description: DEAQ-box RNA dependent ATPase 1, Alternative Gene Names: FLJ23757, Validated applications: ICC, Uniprot ID: Q8TE96, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 85% Rat gene identity: 85%
| Schlagworte: | Anti-DQX1, EC=3.6.4.12, Anti-DEAQ box polypeptide 1, Anti-ATP-dependent RNA helicase DQX1 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
361,00 €
DQX1 PrEST Antigen
Artikelnummer: ATA-APrEST79101.100
Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | DQX1, EC=3.6.4.12, DEAQ box polypeptide 1, ATP-dependent RNA helicase DQX1 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Anti-DQX1
Artikelnummer: ABD-8C14660.50
Custom conjugation services for this antibody as available (eg. labeling of Anti-DQX1 with HRP. Available labels are AF: AF350, AF488, AF555, AF594, AF647, AF680, AF700, AF750. Proteins: HRP, Alkaline Phosphatase, Streptavidin. Tandems: APC, APC/Cy7, APC/AF750, APC/iFluor(TM) 700, APC/iFluor(TM) 750, PE, PE/Cy5,...
| Schlagworte: | Anti-DQX1, EC=3.6.4.12, Anti-DEAQ box polypeptide 1, Anti-ATP-dependent RNA helicase DQX1, DQX1 Antibody |
| Anwendung: | WB, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
628,00 €
Anti-DQX1
Artikelnummer: ELK-ES2197.100
similarity:Contains 1 helicase ATP-binding domain.,similarity:Contains 1 helicase C-terminal domain., Recommended dilutions: Western Blot: 1/500 - 1/2000. ELISA: 1/20000. Not yet tested in other applications.. Cellular localization: Nucleus .
| Schlagworte: | Anti-DQX1, EC=3.6.4.12, Anti-DEAQ box polypeptide 1, Anti-ATP-dependent RNA helicase DQX1, DQX1 rabbit pAb |
| Anwendung: | WB, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, monkey |
ab 173,00 €
DQX1 (human), recombinant protein
Artikelnummer: ABS-PP-12215.100
| Schlagworte: | ATP-dependent RNA helicase DQX1, DEAQ box polypeptide 1, Recombinant Human DQX1 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 26.5 kD |
ab 90,00 €
DQX1 PrEST Antigen
Artikelnummer: ATA-APrEST96116.100
PrEST Antigen DQX1, Gene description: DEAQ-box RNA dependent ATPase 1, Alternative Gene Names: FLJ23757, Antigen sequence: VSGYFLKVARDTDGTGNYLLLTHKHVAQLSSYCCYRSRRAPARPPPWVLYHNFTISKDNCLSIVSEIQPQMLVEL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 85% Rat gene identity:...
| Schlagworte: | DQX1, EC=3.6.4.12, DEAQ box polypeptide 1, ATP-dependent RNA helicase DQX1 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
DQX1 (human), recombinant protein
Artikelnummer: ABS-PP-12215-L.100
| Schlagworte: | ATP-dependent RNA helicase DQX1, DEAQ box polypeptide 1, Recombinant Human DQX1 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 26.5 kD |
ab 115,00 €