Zu "GeneID 159163" wurden 12 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-RBMY1F
Artikelnummer: ATA-HPA053147.100
Protein function: RNA-binding protein which may be involved in spermatogenesis. Required for sperm development, possibly by participating in pre-mRNA splicing in the testis. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity...
| Schlagworte: | Anti-YRRM2, Anti-RBMY1J, Anti-RBMY1F, Anti-Y chromosome RNA recognition motif 2, Anti-RNA-binding motif protein, Y... |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
RNA-binding motif protein, Y chromosome, family 1 member...
Artikelnummer: CSB-EP614891HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-496aa. Protein Length: Full Length. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: MVEADHPGKL FIGGLNRETN EKMLKAVFGK HGPISEVLLI KDRTSKSRGF AFITFENPAD AKNAAKDMNG TSLHGKAIKV EQAKKPSFQS GGRRRPPASS RNRSPSGSLR SARGSSGGTR GWLPSHEGHL...
| Schlagworte: | YRRM2, RBMY1J, RBMY1F, Y chromosome RNA recognition motif 2, RNA-binding motif protein, Y chromosome, family 1 member F/J,... |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 71.7 kD |
ab 219,00 €
Anti-RBMY1F
Artikelnummer: ATA-HPA057723.100
Polyclonal Antibody against Human RBMY1F, Gene description: RNA binding motif protein Y-linked family 1 member F, Alternative Gene Names: MGC33094, Validated applications: ICC, Uniprot ID: Q15415, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: RNA-binding...
| Schlagworte: | Anti-YRRM2, Anti-RBMY1F, Anti-RBMY1J, Anti-Y chromosome RNA recognition motif 2, Anti-RNA-binding motif protein, Y... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
RBMY1F, Recombinant, Human, aa1-496, His-SUMO-Tag...
Artikelnummer: 375005.1
RNA-binding protein which may be involved in spermatogenesis. Required for sperm development, possibly by participating in pre-mRNA splicing in the testis. Source: Recombinant protein corresponding to aa1-496 from human RBMY1F, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~71.7kD, AA...
| Schlagworte: | YRRM2, RBMY1F, RBMY1J, Y chromosome RNA recognition motif 2, RNA-binding motif protein, Y chromosome, family 1 member F/J |
| MW: | 71,7 |
ab 603,00 €
RBMY1F PrEST Antigen
Artikelnummer: ATA-APrEST89144.100
Protein function: RNA-binding protein which may be involved in spermatogenesis. Required for sperm development, possibly by participating in pre-mRNA splicing in the testis. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | YRRM2, RBMY1J, RBMY1F, Y chromosome RNA recognition motif 2, RNA-binding motif protein, Y chromosome, family 1 member F/J |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Anti-RBMY1F
Artikelnummer: G-CAB16604.20
Protein function: RNA-binding protein which may be involved in spermatogenesis. Required for sperm development, possibly by participating in pre-mRNA splicing in the testis. [The UniProt Consortium]
| Schlagworte: | Anti-YRRM2, Anti-RBMY1J, Anti-RBMY1F, Anti-Y chromosome RNA recognition motif 2, Anti-RNA-binding motif protein, Y... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | rat |
149,00 €
RBMY1F (Vector Vector will be determined during the...
Artikelnummer: CSB-CL614891HU.10
Length: 1491 Sequence: atggtagaag cagatcatcc tggcaagctt ttcattggtg gcctcaatag agaaaccaat gagaagatgc ttaaagcagt atttgggaaa catggtccca tatcagaagt tcttttgata aaggatcgaa ccagcaaatc cagaggcttt gcatttatta cttttgagaa ccctgcagat gctaagaatg ctgcgaaaga tatgaatgga acgtctttgc atggaaaagc aataaaagta gaacaagcca agaaaccatc...
| Schlagworte: | YRRM2, RBMY1J, RBMY1F, Y chromosome RNA recognition motif 2, RNA-binding motif protein, Y chromosome, family 1 member F/J |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
176,00 €
Anti-RBMY1F
Artikelnummer: CSB-PA614891LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RBMY1F. Antigen Species: Human
| Schlagworte: | Anti-YRRM2, Anti-RBMY1J, Anti-RBMY1F, Anti-Y chromosome RNA recognition motif 2, Anti-RNA-binding motif protein, Y... |
| Anwendung: | ELISA, WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Anti-RBMY1F, HRP conjugated
Artikelnummer: CSB-PA614891LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RBMY1F. Antigen Species: Human
| Schlagworte: | Anti-YRRM2, Anti-RBMY1J, Anti-RBMY1F, Anti-Y chromosome RNA recognition motif 2, Anti-RNA-binding motif protein, Y... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Anti-RBMY1F, FITC conjugated
Artikelnummer: CSB-PA614891LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RBMY1F. Antigen Species: Human
| Schlagworte: | Anti-YRRM2, Anti-RBMY1J, Anti-RBMY1F, Anti-Y chromosome RNA recognition motif 2, Anti-RNA-binding motif protein, Y... |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Anti-RBMY1F, Biotin conjugated
Artikelnummer: CSB-PA614891LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RBMY1F. Antigen Species: Human
| Schlagworte: | Anti-YRRM2, Anti-RBMY1J, Anti-RBMY1F, Anti-Y chromosome RNA recognition motif 2, Anti-RNA-binding motif protein, Y... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
RBMY1F PrEST Antigen
Artikelnummer: ATA-APrEST95767.100
PrEST Antigen RBMY1F, Gene description: RNA binding motif protein Y-linked family 1 member F, Alternative Gene Names: MGC33094, Antigen sequence: WRNDRMSTRHDGYATNDGNHPSCQETRDYA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: RNA-binding protein which may be involved in...
| Schlagworte: | YRRM2, RBMY1J, RBMY1F, Y chromosome RNA recognition motif 2, RNA-binding motif protein, Y chromosome, family 1 member F/J |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €