- Suchergebnis für GeneID 1585
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 1585" wurden 23 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA049565.100
Polyclonal Antibody against Human CYP11B2, Gene description: cytochrome P450 family 11 subfamily B member 2, Alternative Gene Names: ALDOS, CPN2, CYP11B, CYP11BL, P-450C18, P450aldo, Validated applications: ICC, Uniprot ID: P19099, Storage: Store at +4°C for short term storage. Long time storage is recommended at...
Schlagworte: | Anti-ALDOS, Anti-CYPXIB2, Anti-Cytochrome P-450C18, Anti-Cytochrome P-450Aldo, Anti-Aldosterone synthase, Anti-Steroid... |
Anwendung: | ICC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
450,00 €
Artikelnummer: TGM-TMPH-01181-100ug
Description: CYP11B2 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli.
Schlagworte: | Aldosterone-synthesizing enzyme, Cytochrome P-450Aldo, CYP11B2, Cytochrome P450 11B2, mitochondrial, CYPXIB2, Aldosterone... |
MW: | 71.0 kD |
ab 281,00 €
Artikelnummer: CSB-EP006391HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 25-503aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: GTRAARAPRT VLPFEAMPQH PGNRWLRLLQ IWREQGYEHL HLEMHQTFQE LGPIFRYNLG GPRMVCVMLP EDVEKLQQVD SLHPCRMILE PWVAYRQHRG HKCGVFLLNG...
Schlagworte: | ALDOS, CYPXIB2, Cytochrome P-450C18, Aldosterone synthase, Cytochrome P-450Aldo, Steroid 18-hydroxylase,... |
Anwendung: | Activity not tested |
Exprimiert in: | E.coli |
Ursprungsart: | human |
MW: | 71 kD |
ab 292,00 €
Artikelnummer: CSB-YP006391HU.1
Organism: Homo sapiens (Human). Source: Yeast. Expression Region: 25-503aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: GTRAARAPRT VLPFEAMPQH PGNRWLRLLQ IWREQGYEHL HLEMHQTFQE LGPIFRYNLG GPRMVCVMLP EDVEKLQQVD SLHPCRMILE PWVAYRQHRG HKCGVFLLNG PEWRFNRLRL...
Schlagworte: | ALDOS, CYPXIB2, Cytochrome P-450C18, Aldosterone synthase, Cytochrome P-450Aldo, Steroid 18-hydroxylase,... |
Anwendung: | Activity not tested |
Exprimiert in: | Yeast |
Ursprungsart: | human |
MW: | 57 kD |
ab 347,00 €
Artikelnummer: E-AB-17738.120
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane. The enzyme has...
Schlagworte: | Anti-ALDOS, Anti-CYPXIB2, Anti-Cytochrome P-450C18, Anti-Aldosterone synthase, Anti-Cytochrome P-450Aldo, Anti-Steroid... |
Anwendung: | WB, IHC, ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 89,00 €
Artikelnummer: E-AB-66284.120
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane. The enzyme has...
Schlagworte: | Anti-ALDOS, Anti-CYPXIB2, Anti-Cytochrome P-450C18, Anti-Cytochrome P-450Aldo, Anti-Aldosterone synthase, Anti-Steroid... |
Anwendung: | IHC, IF |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat |
ab 243,00 €
Artikelnummer: ATA-HPA049171.100
Protein function: A cytochrome P450 monooxygenase that catalyzes the biosynthesis of adrenal mineralocorticoid aldosterone (PubMed:11856349, PubMed:23322723, PubMed:1594605, PubMed:9814506). Catalyzes three sequential oxidative reactions of 11-deoxycorticosterone/21- hydroxyprogesterone, namely 11-beta hydroxylation...
Schlagworte: | Anti-ALDOS, Anti-CYPXIB2, Anti-Cytochrome P-450C18, Anti-Cytochrome P-450Aldo, Anti-Aldosterone synthase, Anti-Steroid... |
Anwendung: | IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 320,00 €
Artikelnummer: ATA-HPA057752.100
Protein function: A cytochrome P450 monooxygenase that catalyzes the biosynthesis of adrenal mineralocorticoid aldosterone (PubMed:11856349, PubMed:23322723, PubMed:1594605, PubMed:9814506). Catalyzes three sequential oxidative reactions of 11-deoxycorticosterone/21- hydroxyprogesterone, namely 11-beta hydroxylation...
Schlagworte: | Anti-ALDOS, Anti-CYPXIB2, Anti-Cytochrome P-450C18, Anti-Cytochrome P-450Aldo, Anti-Aldosterone synthase, Anti-Steroid... |
Anwendung: | IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 320,00 €
Artikelnummer: ELK-ELK5606.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human ALDOS. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human ALDOS. Next,...
Schlagworte: | ALDOS, CYPXIB2, Cytochrome P-450C18, Cytochrome P-450Aldo, Aldosterone synthase, Steroid 18-hydroxylase,... |
Anwendung: | ELISA |
Spezies-Reaktivität: | human |
ab 374,00 €

Artikelnummer: ABS-RC-6837.100
Protein function: A cytochrome P450 monooxygenase that catalyzes the biosynthesis of adrenal mineralocorticoid aldosterone (PubMed:11856349, PubMed:23322723, PubMed:1594605, PubMed:9814506). Catalyzes three sequential oxidative reactions of 11-deoxycorticosterone/21- hydroxyprogesterone, namely 11-beta hydroxylation...
Schlagworte: | Anti-Cytochrome P450 11B2, Anti-mitochondrial, Anti-Aldosterone synthase, Anti-ALDOS, Anti-Aldosterone-synthesizing... |
Anwendung: | WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 206,00 €

Artikelnummer: ATA-APrEST96158.100
PrEST Antigen CYP11B2, Gene description: cytochrome P450 family 11 subfamily B member 2, Alternative Gene Names: ALDOS, CPN2, CYP11B, CYP11BL, P-450C18, P450aldo, Antigen sequence: WVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: A...
Schlagworte: | ALDOS, CYPXIB2, Cytochrome P-450C18, Aldosterone synthase, Cytochrome P-450Aldo, Steroid 18-hydroxylase,... |
Exprimiert in: | E.coli |
Ursprungsart: | human |
265,00 €

Artikelnummer: CSB-PA006391LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CYP11B2. Antigen Species: Human
Schlagworte: | Anti-ALDOS, Anti-CYPXIB2, Anti-Cytochrome P-450C18, Anti-Aldosterone synthase, Anti-Cytochrome P-450Aldo, Anti-Steroid... |
Anwendung: | ELISA, IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 167,00 €