Zu "GeneID 1585" wurden 23 Artikel gefunden!

1 von 2 Seiten
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-CYP11B2
Anti-CYP11B2

Artikelnummer: ATA-HPA049565.100

Polyclonal Antibody against Human CYP11B2, Gene description: cytochrome P450 family 11 subfamily B member 2, Alternative Gene Names: ALDOS, CPN2, CYP11B, CYP11BL, P-450C18, P450aldo, Validated applications: ICC, Uniprot ID: P19099, Storage: Store at +4°C for short term storage. Long time storage is recommended at...
Schlagworte: Anti-ALDOS, Anti-CYPXIB2, Anti-Cytochrome P-450C18, Anti-Cytochrome P-450Aldo, Anti-Aldosterone synthase, Anti-Steroid...
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
450,00 €
Bewerten
CYP11B2 Protein, Human, Recombinant (His & SUMO)
CYP11B2 Protein, Human, Recombinant (His & SUMO)

Artikelnummer: TGM-TMPH-01181-100ug

Description: CYP11B2 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli.
Schlagworte: Aldosterone-synthesizing enzyme, Cytochrome P-450Aldo, CYP11B2, Cytochrome P450 11B2, mitochondrial, CYPXIB2, Aldosterone...
MW: 71.0 kD
ab 281,00 €
Bewerten
Cytochrome P450 11B2, mitochondrial (CYP11B2), human, recombinant
Cytochrome P450 11B2, mitochondrial (CYP11B2), human,...

Artikelnummer: CSB-EP006391HU.1

Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 25-503aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: GTRAARAPRT VLPFEAMPQH PGNRWLRLLQ IWREQGYEHL HLEMHQTFQE LGPIFRYNLG GPRMVCVMLP EDVEKLQQVD SLHPCRMILE PWVAYRQHRG HKCGVFLLNG...
Schlagworte: ALDOS, CYPXIB2, Cytochrome P-450C18, Aldosterone synthase, Cytochrome P-450Aldo, Steroid 18-hydroxylase,...
Anwendung: Activity not tested
Exprimiert in: E.coli
Ursprungsart: human
MW: 71 kD
ab 292,00 €
Bewerten
Cytochrome P450 11B2, mitochondrial (CYP11B2), human, recombinant
Cytochrome P450 11B2, mitochondrial (CYP11B2), human,...

Artikelnummer: CSB-YP006391HU.1

Organism: Homo sapiens (Human). Source: Yeast. Expression Region: 25-503aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: GTRAARAPRT VLPFEAMPQH PGNRWLRLLQ IWREQGYEHL HLEMHQTFQE LGPIFRYNLG GPRMVCVMLP EDVEKLQQVD SLHPCRMILE PWVAYRQHRG HKCGVFLLNG PEWRFNRLRL...
Schlagworte: ALDOS, CYPXIB2, Cytochrome P-450C18, Aldosterone synthase, Cytochrome P-450Aldo, Steroid 18-hydroxylase,...
Anwendung: Activity not tested
Exprimiert in: Yeast
Ursprungsart: human
MW: 57 kD
ab 347,00 €
Bewerten
Anti-CYP11B2
Anti-CYP11B2

Artikelnummer: E-AB-17738.120

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane. The enzyme has...
Schlagworte: Anti-ALDOS, Anti-CYPXIB2, Anti-Cytochrome P-450C18, Anti-Aldosterone synthase, Anti-Cytochrome P-450Aldo, Anti-Steroid...
Anwendung: WB, IHC, ELISA
Wirt: Rabbit
Spezies-Reaktivität: human
ab 89,00 €
Bewerten
Anti-CYP11B2
Anti-CYP11B2

Artikelnummer: E-AB-66284.120

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane. The enzyme has...
Schlagworte: Anti-ALDOS, Anti-CYPXIB2, Anti-Cytochrome P-450C18, Anti-Cytochrome P-450Aldo, Anti-Aldosterone synthase, Anti-Steroid...
Anwendung: IHC, IF
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
ab 243,00 €
Bewerten
Anti-CYP11B2
Anti-CYP11B2

Artikelnummer: ATA-HPA049171.100

Protein function: A cytochrome P450 monooxygenase that catalyzes the biosynthesis of adrenal mineralocorticoid aldosterone (PubMed:11856349, PubMed:23322723, PubMed:1594605, PubMed:9814506). Catalyzes three sequential oxidative reactions of 11-deoxycorticosterone/21- hydroxyprogesterone, namely 11-beta hydroxylation...
Schlagworte: Anti-ALDOS, Anti-CYPXIB2, Anti-Cytochrome P-450C18, Anti-Cytochrome P-450Aldo, Anti-Aldosterone synthase, Anti-Steroid...
Anwendung: IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 320,00 €
Bewerten
Anti-CYP11B2
Anti-CYP11B2

Artikelnummer: ATA-HPA057752.100

Protein function: A cytochrome P450 monooxygenase that catalyzes the biosynthesis of adrenal mineralocorticoid aldosterone (PubMed:11856349, PubMed:23322723, PubMed:1594605, PubMed:9814506). Catalyzes three sequential oxidative reactions of 11-deoxycorticosterone/21- hydroxyprogesterone, namely 11-beta hydroxylation...
Schlagworte: Anti-ALDOS, Anti-CYPXIB2, Anti-Cytochrome P-450C18, Anti-Cytochrome P-450Aldo, Anti-Aldosterone synthase, Anti-Steroid...
Anwendung: IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 320,00 €
Bewerten
Human ALDOS (Aldosterone Synthase) ELISA Kit
Human ALDOS (Aldosterone Synthase) ELISA Kit

Artikelnummer: ELK-ELK5606.48

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human ALDOS. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human ALDOS. Next,...
Schlagworte: ALDOS, CYPXIB2, Cytochrome P-450C18, Cytochrome P-450Aldo, Aldosterone synthase, Steroid 18-hydroxylase,...
Anwendung: ELISA
Spezies-Reaktivität: human
ab 374,00 €
Bewerten
Anti-CYP11B2 Recombinant
Anti-CYP11B2 Recombinant

Artikelnummer: ABS-RC-6837.100

Protein function: A cytochrome P450 monooxygenase that catalyzes the biosynthesis of adrenal mineralocorticoid aldosterone (PubMed:11856349, PubMed:23322723, PubMed:1594605, PubMed:9814506). Catalyzes three sequential oxidative reactions of 11-deoxycorticosterone/21- hydroxyprogesterone, namely 11-beta hydroxylation...
Schlagworte: Anti-Cytochrome P450 11B2, Anti-mitochondrial, Anti-Aldosterone synthase, Anti-ALDOS, Anti-Aldosterone-synthesizing...
Anwendung: WB
Wirt: Rabbit
Spezies-Reaktivität: human
ab 206,00 €
Bewerten
CYP11B2 PrEST Antigen
CYP11B2 PrEST Antigen

Artikelnummer: ATA-APrEST96158.100

PrEST Antigen CYP11B2, Gene description: cytochrome P450 family 11 subfamily B member 2, Alternative Gene Names: ALDOS, CPN2, CYP11B, CYP11BL, P-450C18, P450aldo, Antigen sequence: WVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: A...
Schlagworte: ALDOS, CYPXIB2, Cytochrome P-450C18, Aldosterone synthase, Cytochrome P-450Aldo, Steroid 18-hydroxylase,...
Exprimiert in: E.coli
Ursprungsart: human
265,00 €
Bewerten
Anti-CYP11B2
Anti-CYP11B2

Artikelnummer: CSB-PA006391LA01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CYP11B2. Antigen Species: Human
Schlagworte: Anti-ALDOS, Anti-CYPXIB2, Anti-Cytochrome P-450C18, Anti-Aldosterone synthase, Anti-Cytochrome P-450Aldo, Anti-Steroid...
Anwendung: ELISA, IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
1 von 2 Seiten