Zu "GeneID 152405" wurden 8 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
Anti-C3orf30
Anti-C3orf30

Artikelnummer: ATA-HPA062468.100

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 40% and to rat: 42%
Schlagworte: Anti-C3orf30, Anti-Testis-specific expressed protein 55, Anti-Testis-specific conserved, cAMP-dependent type II...
Anwendung: IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 330,00 €
Bewerten
Anti-TEX55
Anti-TEX55

Artikelnummer: ATA-HPA068480.100

Polyclonal Antibody against Human TEX55, Gene description: testis expressed 55, Alternative Gene Names: C3orf30, FLJ32859, TSCPA, Validated applications: ICC, Uniprot ID: Q96M34, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 25% Rat gene identity: 25%
Schlagworte: Anti-C3orf30, Anti-Testis-specific expressed protein 55, Anti-Testis-specific conserved, cAMP-dependent type II...
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
491,00 €
Bewerten
Anti-TEX55
Anti-TEX55

Artikelnummer: ATA-HPA068480.25

Polyclonal Antibody against Human TEX55, Gene description: testis expressed 55, Alternative Gene Names: C3orf30, FLJ32859, TSCPA, Validated applications: ICC, Uniprot ID: Q96M34, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 25% Rat gene identity: 25%
Schlagworte: Anti-C3orf30, Anti-Testis-specific expressed protein 55, Anti-Testis-specific conserved, cAMP-dependent type II...
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
361,00 €
Bewerten
C3orf30 PrEST Antigen
C3orf30 PrEST Antigen

Artikelnummer: ATA-APrEST87967.100

Buffer: PBS and 1M Urea, pH 7.4.
Schlagworte: C3orf30, Testis-specific expressed protein 55, Testis-specific conserved, cAMP-dependent type II PK-anchoring protein
Anwendung: Control antigen
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
C3orf30 (Vector pUC, Accession No. BC130475)
C3orf30 (Vector pUC, Accession No. BC130475)

Artikelnummer: CSB-CL822257HU.10

Length: 1611 Sequence: atggaagagc ctccgcaaga ggctctggct gaacccttga aacatgaaag cccagccgct ccctcaagtg ctggccacac taagggccag gaagaagacg accagaagaa ccaggccgaa aggaaggcag ataaccacac tgctcacaga atagctgacc agactgccct aagagtgcct agccaggctg aatccagcat atttagccaa gctaccaacg gagtagctga acaaaatggg catagtacac ctggtcaggc...
Schlagworte: C3orf30, Testis-specific expressed protein 55, Testis-specific conserved, cAMP-dependent type II PK-anchoring protein
Anwendung: Molecular biology, clone
Spezies-Reaktivität: human
592,00 €
Bewerten
TEX55 (human), recombinant protein
TEX55 (human), recombinant protein

Artikelnummer: ABS-PP-2645.100

Schlagworte: Testis-specific expressed protein 55, Testis-specific conserved, cAMP-dependent type II PK-anchoring protein, Recombinant...
Exprimiert in: E.coli
Ursprungsart: human
MW: 16 kD
ab 90,00 €
Bewerten
TEX55 PrEST Antigen
TEX55 PrEST Antigen

Artikelnummer: ATA-APrEST95700.100

PrEST Antigen TEX55, Gene description: testis expressed 55, Alternative Gene Names: C3orf30, FLJ32859, TSCPA, Antigen sequence: DYRLAGLADPGTSEQTDLRLYGLVDHKTSVKTHHQVYGQATELAEHQAIDQAHSNADQPPVDNAHYTESDQTDHLADRQAN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 25% Rat...
Schlagworte: C3orf30, Testis-specific expressed protein 55, Testis-specific conserved, cAMP-dependent type II PK-anchoring protein
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
TEX55 (human), recombinant protein
TEX55 (human), recombinant protein

Artikelnummer: ABS-PP-2645-L.100

Schlagworte: Testis-specific expressed protein 55, Testis-specific conserved, cAMP-dependent type II PK-anchoring protein, Recombinant...
Exprimiert in: E.coli
Ursprungsart: human
MW: 16 kD
ab 115,00 €
Bewerten