Zu "GeneID 1521" wurden 9 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Cathepsin W Protein, Human, Recombinant (His & Myc)
Artikelnummer: TGM-TMPH-03836-100ug
Description: Cathepsin W Protein, Human, Recombinant (His & Myc) is expressed in E. coli with N-10xHis, C-Myc. The accession number is P56202.
| Schlagworte: | Cathepsin W , CTSW , Lymphopain |
| MW: | 33.1 kD |
ab 122,00 €
Cathepsin W (CTSW), human, recombinant
Artikelnummer: CSB-EP006205HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 128-376aa. Protein Length: Full Length. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Target Protein Sequence: VPFSCDWRKV ASAISPIKDQ KNCNCCWAMA AAGNIETLWR ISFWDFVDVS VQELLDCGRC GDGCHGGFVW DAFITVLNNS GLASEKDYPF QGKVRAHRCH PKKYQKVAWI...
| Schlagworte: | CTSW, Lymphopain, EC=3.4.22.-, Cathepsin W, Recombinant Human Cathepsin W (CTSW) |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 33.1 kD |
ab 364,00 €
Anti-CTSW
Artikelnummer: ATA-HPA066903.100
Polyclonal Antibody against Human CTSW, Gene description: cathepsin W, Validated applications: IHC, Uniprot ID: P56202, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May have a specific function in the mechanism or regulation of T-cell cytolytic activity....
| Schlagworte: | Anti-CTSW, Anti-Lymphopain, Anti-Cathepsin W, EC=3.4.22.- |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
CTSW (human), recombinant protein
Artikelnummer: ABS-PP-11900-L.100
Protein function: May have a specific function in the mechanism or regulation of T-cell cytolytic activity. [The UniProt Consortium]
| Schlagworte: | Cathepsin W, Lymphopain, Recombinant Human CTSW Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 40.5 kD |
ab 115,00 €
CTSW, Human cathepsin W, Real Time PCR Primer Set
Artikelnummer: VHPS-2334
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | CTSW, Lymphopain, Cathepsin W, EC=3.4.22.- |
| Anwendung: | RNA quantification |
45,00 €
Anti-cleaved-CATW (Val128)
Artikelnummer: ELK-ES19963.100
Protein function: May have a specific function in the mechanism or regulation of T-cell cytolytic activity. [The UniProt Consortium] Recommended dilutions: WB 1:1000-2000 ELISA 1:5000-20000. Cellular localization: Endoplasmic reticulum .
| Schlagworte: | Anti-cleaved-CTSW, Anti-cleaved-Lymphopain, Anti-cleaved-Cathepsin W, EC=3.4.22.-, CATW (Cleaved-Val128) rabbit pAb |
| Anwendung: | WB, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 173,00 €
CTSW (Vector pUC, Accession No. BC048255)
Artikelnummer: CSB-CL006205HU.10
Length: 1131 Sequence: atggcactga ctgcccaccc ctcctgcctc ctggccctgt tggtggcagg cctagcccaa ggcatcagag gcccccttag ggcccaggac ctaggtcccc agccgctaga gctgaaagag gccttcaagt tgttccagat ccagttcaac cggagttacc tgagcccaga agagcatgct caccgcctgg acatctttgc ccacaacctg gcccaggctc agaggctgca ggaggaggac ttgggcacag ctgagtttgg...
| Schlagworte: | CTSW, Lymphopain, EC=3.4.22.-, Cathepsin W |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
421,00 €
CTSW (human), recombinant protein
Artikelnummer: ABS-PP-11900.100
Protein function: May have a specific function in the mechanism or regulation of T-cell cytolytic activity. [The UniProt Consortium]
| Schlagworte: | Cathepsin W, Lymphopain, Recombinant Human CTSW Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 40.5 kD |
ab 90,00 €
CTSW PrEST Antigen
Artikelnummer: ATA-APrEST95971.100
PrEST Antigen CTSW, Gene description: cathepsin W, Antigen sequence: EEFGQLYGYRRAAGGVPSMGREIRSEEPEESVPFSCDWRKVAGAISPIKDQKNCNCCWAMAAAGNIETLWRISFWD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May have a specific function in the mechanism or regulation of T-cell...
| Schlagworte: | CTSW, Lymphopain, Cathepsin W, EC=3.4.22.- |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €