Zu "GeneID 147409" wurden 11 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-DSG4
Artikelnummer: ATA-HPA059456.100
Protein function: Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Coordinates the transition from proliferation to differentiation in hair follicle keratinocytes. [The UniProt Consortium] Buffer: 40% glycerol and...
| Schlagworte: | Anti-DSG4, Anti-CDHF13, Anti-Desmoglein-4, Anti-Cadherin family member 13 |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
DSG4 (human), recombinant protein
Artikelnummer: ABS-PP-539.100
Protein function: Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Coordinates the transition from proliferation to differentiation in hair follicle keratinocytes. [The UniProt Consortium]
| Schlagworte: | Desmoglein-4, Cadherin family member 13, Recombinant Human DSG4 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 21 kD |
ab 90,00 €
Anti-DSG4
Artikelnummer: ATA-HPA079244.100
Polyclonal Antibody against Human DSG4, Gene description: desmoglein 4, Alternative Gene Names: CDHF13, LAH, Validated applications: IHC, Uniprot ID: Q86SJ6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Component of intercellular desmosome junctions....
| Schlagworte: | Anti-DSG4, Anti-CDHF13, Anti-Desmoglein-4, Anti-Cadherin family member 13 |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Anti-DSG4
Artikelnummer: ABS-KC-32557.100
Protein function: Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Coordinates the transition from proliferation to differentiation in hair follicle keratinocytes. [The UniProt Consortium]
| Schlagworte: | Anti-DSG4, Anti-CDHF13, Anti-Desmoglein-4, Anti-Cadherin family member 13 |
| Anwendung: | IHC |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human |
ab 206,00 €
Anti-DSG4
Artikelnummer: ABS-KC-32659.100
Protein function: Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Coordinates the transition from proliferation to differentiation in hair follicle keratinocytes. [The UniProt Consortium]
| Schlagworte: | Anti-DSG4, Anti-CDHF13, Anti-Desmoglein-4, Anti-Cadherin family member 13 |
| Anwendung: | IHC |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human |
ab 206,00 €
Anti-DSG4
Artikelnummer: ABS-KC-32679.100
Protein function: Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Coordinates the transition from proliferation to differentiation in hair follicle keratinocytes. [The UniProt Consortium]
| Schlagworte: | Anti-DSG4, Anti-CDHF13, Anti-Desmoglein-4, Anti-Cadherin family member 13 |
| Anwendung: | IHC |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human |
ab 206,00 €
DSG4 (human), recombinant protein
Artikelnummer: ABS-PP-539-L.100
Protein function: Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Coordinates the transition from proliferation to differentiation in hair follicle keratinocytes. [The UniProt Consortium]
| Schlagworte: | Desmoglein-4, Cadherin family member 13, Recombinant Human DSG4 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 21 kD |
ab 115,00 €
Anti-DSG4 (Desmoglein 4, Cadherin family member 13,...
Artikelnummer: D3221-85.100
Desmoglein-4 is ~110kD type I transmembrane glycoprotein in the cadherin family of calcium-dependent cell adhesion molecules. Desmogleins interact with transmembrane Desmocollins to form the adhesive components of desmosomes on epithelial cells. Desmoglein-4 contains four cadherin repeats in its extracellular region...
| Anwendung: | WB |
| Wirt: | Sheep |
| Spezies-Reaktivität: | human |
1.025,00 €
DSG4 PrEST Antigen
Artikelnummer: ATA-APrEST85759.100
Protein function: Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Coordinates the transition from proliferation to differentiation in hair follicle keratinocytes. [The UniProt Consortium] Buffer: PBS and 1M Urea,...
| Schlagworte: | DSG4, CDHF13, Desmoglein-4, Cadherin family member 13 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Anti-DSG4
Artikelnummer: ELK-ES9587.100
This gene encodes a member of the desmoglein subgroup of desmosomal cadherins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a transmembrane component of desmosomes and may play a role in cell-cell adhesion in epithelial cells. Mutations in the gene are...
| Schlagworte: | Anti-DSG4, Anti-CDHF13, Anti-Desmoglein-4, Anti-Cadherin family member 13, DSG4 rabbit pAb |
| Anwendung: | WB, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 173,00 €
DSG4 PrEST Antigen
Artikelnummer: ATA-APrEST95823.100
PrEST Antigen DSG4, Gene description: desmoglein 4, Alternative Gene Names: CDHF13, LAH, Antigen sequence: PAELADYNNVIYAERVLASPGVPDMSNSSTTEGCMGPVMSGNILVGPEIQVMQMMSPDLPIGQTVGSTSPMTSRHRVTRYSNIHYTQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Component of intercellular...
| Schlagworte: | DSG4, CDHF13, Desmoglein-4, Cadherin family member 13 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €