Zu "GeneID 140873" wurden 5 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-C20orf173
Artikelnummer: ATA-HPA076859.100
Polyclonal Antibody against Human C20orf173, Gene description: chromosome 20 open reading frame 173, Alternative Gene Names: dJ477O4.4, Validated applications: ICC, Uniprot ID: Q96LM9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 31% Rat gene...
| Schlagworte: | Anti-C20orf173, Anti-Uncharacterized protein C20orf173 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
C20orf173, Human chromosome 20 open reading frame 173,...
Artikelnummer: VHPS-1184
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | C20orf173 |
| Anwendung: | RNA quantification |
45,00 €
Anti-CT173, ID (C20orf173, Uncharacterized protein...
Artikelnummer: 034312.200
Applications:, Suitable for use in Western Blot, Immunohistochemistry, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Immunohistochemistry: 1:50-100, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are...
| Schlagworte: | Anti-C20orf173, Anti-Uncharacterized protein C20orf173 |
| Anwendung: | ELISA, IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
865,00 €
Anti-CT173
Artikelnummer: ELK-ES17195.100
Recommended dilutions: WB 1:500-2000. Cellular localization: integral component of membrane,
| Schlagworte: | Anti-C20orf173, Anti- C20orf173, CT173 rabbit pAb |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, rat, mouse, |
ab 173,00 €
C20orf173 PrEST Antigen
Artikelnummer: ATA-APrEST96207.100
PrEST Antigen C20orf173, Gene description: chromosome 20 open reading frame 173, Alternative Gene Names: dJ477O4.4, Antigen sequence: VLLGRPQIPQGSSLGNDIDQYPVVFRNASDQGSWMQLEMLLRKLSDLVWTSDALSDKILED, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 31% Rat gene identity: 31%
| Schlagworte: | C20orf173, Uncharacterized protein C20orf173 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
