Zu "GeneID 128308" wurden 11 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
Anti-MRPL55
Anti-MRPL55

Artikelnummer: ATA-HPA027641.100

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 79% and to rat: 78%
Schlagworte: Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial, Anti-Mitochondrial large ribosomal...
Anwendung: ICC, IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 246,00 €
Bewerten
39S ribosomal protein L55, mitochondrial (MRPL55), human, recombinant
39S ribosomal protein L55, mitochondrial (MRPL55), human,...

Artikelnummer: CSB-EP014872HU.1

Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 34-128aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal GST-tagged. Target Protein Sequence: DSSRASLTRV HRQAYARLYP VLLVKQDGST IHIRYREPRR MLAMPIDLDT LSPEERRARL RKREAQLQSR KEYEQELSDD LHVERYRQFW TRTKK. Purity: Greater than 90% as...
Schlagworte: L55mt, MRPL55, MRP-L55, 39S ribosomal protein L55, mitochondrial, Mitochondrial large ribosomal subunit protein mL55,...
Anwendung: Activity not tested
Exprimiert in: E.coli
Ursprungsart: human
MW: 38.6 kD
ab 219,00 €
Bewerten
MRPL55, Recombinant, Human, aa34-128, GST-Tag (39S Ribosomal Protein L55, Mitochondrial)
MRPL55, Recombinant, Human, aa34-128, GST-Tag (39S...

Artikelnummer: 374273.1

Source:, Recombinant protein corresponding to aa34-128 from human MRPL55, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.6kD, AA Sequence: DSSRASLTRVHRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPIDLDTLSPEERRARLRKREAQLQSRKEYEQELSDDLHVERYRQFWTRTKK, Storage and Stability: May be stored at 4°C for...
Schlagworte: L55mt, MRPL55, MRP-L55, 39S ribosomal protein L55, mitochondrial, Mitochondrial large ribosomal subunit protein mL55,...
MW: 38,6
ab 603,00 €
Bewerten
MRPL55 PrEST Antigen
MRPL55 PrEST Antigen

Artikelnummer: ATA-APrEST77022.100

Buffer: PBS and 1M Urea, pH 7.4.
Schlagworte: L55mt, MRPL55, MRP-L55, 39S ribosomal protein L55, mitochondrial, Mitochondrial large ribosomal subunit protein mL55,...
Anwendung: Control antigen
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
Anti-MRPL55
Anti-MRPL55

Artikelnummer: G-CAB18242.20

MRPL55 Rabbit Polyclonal Antibody from Assay Genie with reactivity against Human and for use in WB applications.MRPL55 Rabbit Polyclonal Antibody is an IgG isotype antibody and produced in Rabbit and purified by Affinity purification from Assay Genie.
Schlagworte: Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial, Anti-Mitochondrial large ribosomal...
Anwendung: WB
Wirt: Rabbit
Spezies-Reaktivität: human
103,00 €
Bewerten
Anti-RM55
Anti-RM55

Artikelnummer: ELK-ES9307.100

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes,...
Schlagworte: Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-Large ribosomal subunit protein mL55, Anti-39S ribosomal protein L55,...
Anwendung: WB, ELISA
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
ab 173,00 €
Bewerten
MRPL55 (Vector Vector will be determined during the manufacturing process, either pENTR223.1 or pUC,
MRPL55 (Vector Vector will be determined during the...

Artikelnummer: CSB-CL768781HU.10

Length: 387 Sequence: atggcggccg tgggcagcct gcttggccgg ctgaggcaga gcaccgtgaa ggccaccgga cctgcactcc gccgcctgca cacatcctcc tggcgagctg acagcagcag ggcctcactc actcgtgtgc accgccaggc ttatgcacga ctctaccccg tgctgctggt gaagcaggat ggctccacca tccacatccg ctacagggag ccacggcgca tgctggcgat gcccatagat ctggacaccc tgtctcctga...
Schlagworte: L55mt, MRPL55, MRP-L55, 39S ribosomal protein L55, mitochondrial, Mitochondrial large ribosomal subunit protein mL55,...
Anwendung: Molecular biology, clone
Spezies-Reaktivität: human
176,00 €
Bewerten
Anti-MRPL55
Anti-MRPL55

Artikelnummer: CSB-PA014872EA01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MRPL55. Antigen Species: Human
Schlagworte: Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial, Anti-Mitochondrial large ribosomal...
Anwendung: ELISA, WB, IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
Anti-MRPL55, FITC conjugated
Anti-MRPL55, FITC conjugated

Artikelnummer: CSB-PA014872EC01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MRPL55. Antigen Species: Human
Schlagworte: Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial, Anti-Mitochondrial large ribosomal...
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
Anti-MRPL55, HRP conjugated
Anti-MRPL55, HRP conjugated

Artikelnummer: CSB-PA014872EB01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MRPL55. Antigen Species: Human
Schlagworte: Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial, Anti-Mitochondrial large ribosomal...
Anwendung: ELISA
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
Anti-MRPL55, Biotin conjugated
Anti-MRPL55, Biotin conjugated

Artikelnummer: CSB-PA014872ED01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MRPL55. Antigen Species: Human
Schlagworte: Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial, Anti-Mitochondrial large ribosomal...
Anwendung: ELISA
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten