Zu "GeneID 1262" wurden 14 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Cyclic nucleotide-gated cation channel alpha-4 (CNGA4),...
Artikelnummer: CSB-CF808540HU.100
Organism: Homo sapiens (Human). Source: in vitro E.coli expression system. Expression Region: 1-575aa. Protein Length: Full Length. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: MSQDTKVKTT ESSPPAPSKA RKLLPVLDPS GDYYYWWLNT MVFPVMYNLI ILVCRACFPD LQHGYLVAWL VLDYTSDLLY LLDMVVRFHT GFLEQGILVV DKGRISSRYV...
| Schlagworte: | CNG4, CNGA4, CNG-4, CNG channel alpha-4, Cyclic nucleotide-gated channel alpha-4, Cyclic nucleotide-gated cation channel... |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli in vitro |
| Ursprungsart: | human |
| MW: | 82 kD |
ab 1.458,00 €
Anti-CNGA4
Artikelnummer: ATA-HPA074128.100
Polyclonal Antibody against Human CNGA4, Gene description: cyclic nucleotide gated channel subunit alpha 4, Alternative Gene Names: CNCA2, CNG5, CNGB2, OCNC2, OCNCb, Validated applications: ICC, Uniprot ID: Q8IV77, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein...
| Schlagworte: | Anti-CNG4, Anti-CNGA4, Anti-CNG-4, Anti-CNG channel alpha-4, Anti-Cyclic nucleotide-gated channel alpha-4, Anti-Cyclic... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
CNGA4 (human), recombinant protein
Artikelnummer: ABS-PP-2427-L.100
Protein function: Second messenger, cAMP, causes the opening of cation- selective cyclic nucleotide-gated (CNG) channels and depolarization of the neuron (olfactory sensory neurons, OSNs). CNGA4 is the modulatory subunit of this channel which is known to play a central role in the transduction of odorant signals and...
| Schlagworte: | Cyclic nucleotide-gated cation channel alpha-4, Cyclic nucleotide-gated channel alpha-4, CNG channel alpha-4, CNG-4, CNG4,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 29 kD |
ab 115,00 €
Anti-CNGA4, NT (CNGA4, Cyclic nucleotide-gated cation...
Artikelnummer: 034039.200
CNGA4 is a modulatory subunit of vertebrate cyclic nucleotide-gated membrane channels that transduce odorant signals (Munger et al., 2001 [PubMed 11739959]). Applications: Suitable for use in Western Blot, Immunohistochemistry, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500,...
| Schlagworte: | Anti-CNG4, Anti-CNGA4, Anti-CNG-4, Anti-CNG channel alpha-4, Anti-Cyclic nucleotide-gated channel alpha-4, Anti-Cyclic... |
| Anwendung: | ELISA, IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | mouse |
865,00 €
CNGA4 (Vector Vector will be determined during the...
Artikelnummer: CSB-CL808540HU.10
Length: 1728 Sequence: ATGAGCCAGG ACACCAAAGT GAAGACAACA GAGTCCAGTC CCCCAGCCCC ATCCAAGGCC AGGAAGTTGC TGCCTGTCCT GGACCCATCT GGGGATTACT ACTACTGGTG GCTGAACACA ATGGTCTTCC CAGTCATGTA TAACCTCATC ATCCTCGTGT GCAGAGCCTG CTTCCCCGAC TTGCAGCACG GTTATCTGGT GGCCTGGTTG GTGCTGGACT ACACGAGTGA CCTGCTATAC CTACTAGACA TGGTGGTGCG...
| Schlagworte: | CNG4, CNG-4, CNGA4, CNG channel alpha-4, Cyclic nucleotide-gated channel alpha-4, Cyclic nucleotide-gated cation channel... |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
357,00 €
Anti-CNGA4
Artikelnummer: CSB-PA808540LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CNGA4. Antigen Species: Human
| Schlagworte: | Anti-CNG4, Anti-CNG-4, Anti-CNGA4, Anti-CNG channel alpha-4, Anti-Cyclic nucleotide-gated channel alpha-4, Anti-Cyclic... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Anti-CNGA4, HRP conjugated
Artikelnummer: CSB-PA808540LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CNGA4. Antigen Species: Human
| Schlagworte: | Anti-CNG4, Anti-CNG-4, Anti-CNGA4, Anti-CNG channel alpha-4, Anti-Cyclic nucleotide-gated channel alpha-4, Anti-Cyclic... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Anti-CNGA4, FITC conjugated
Artikelnummer: CSB-PA808540LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CNGA4. Antigen Species: Human
| Schlagworte: | Anti-CNG4, Anti-CNG-4, Anti-CNGA4, Anti-CNG channel alpha-4, Anti-Cyclic nucleotide-gated channel alpha-4, Anti-Cyclic... |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Anti-CNGA4, Biotin conjugated
Artikelnummer: CSB-PA808540LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CNGA4. Antigen Species: Human
| Schlagworte: | Anti-CNG4, Anti-CNG-4, Anti-CNGA4, Anti-CNG channel alpha-4, Anti-Cyclic nucleotide-gated channel alpha-4, Anti-Cyclic... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
CNGA4 (human), recombinant protein
Artikelnummer: ABS-PP-2427.100
Protein function: Second messenger, cAMP, causes the opening of cation- selective cyclic nucleotide-gated (CNG) channels and depolarization of the neuron (olfactory sensory neurons, OSNs). CNGA4 is the modulatory subunit of this channel which is known to play a central role in the transduction of odorant signals and...
| Schlagworte: | Cyclic nucleotide-gated cation channel alpha-4, Cyclic nucleotide-gated channel alpha-4, CNG channel alpha-4, CNG-4, CNG4,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 29 kD |
ab 90,00 €
CNGA4 PrEST Antigen
Artikelnummer: ATA-APrEST95627.100
PrEST Antigen CNGA4, Gene description: cyclic nucleotide gated channel subunit alpha 4, Alternative Gene Names: CNCA2, CNG5, CNGB2, OCNC2, OCNCb, Antigen sequence: LLAELESSALKIAYRIERLEWQTREWPMPEDLAEADDEGEPEEGTSKDEEGRAS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
| Schlagworte: | CNG4, CNGA4, CNG-4, CNG channel alpha-4, Cyclic nucleotide-gated channel alpha-4, Cyclic nucleotide-gated cation channel... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Human CNGA4-Strep full length protein-synthetic nanodisc
Artikelnummer: DIM-FLP120748.10
CNGA4 is a modulatory subunit of vertebrate cyclic nucleotide-gated membrane channels that transduce odorant signals (Munger et al., 2001 [PubMed 11739959]).[supplied by OMIM, Mar 2008]. Human CNGA4-Strep full length protein-synthetic nanodisc. Protein function: Second messenger, cAMP, causes the opening of cation-...
| Schlagworte: | CNG4, CNGA4, CNG-4, CNG channel alpha-4, Cyclic nucleotide-gated channel alpha-4, Cyclic nucleotide-gated cation channel... |
| Anwendung: | Full length transmembrane protein, FA, ELISA, screening, immunization, cell-based assays, crystallization |
| Exprimiert in: | Human cells |
| Ursprungsart: | human |
| MW: | 66 kD |
ab 1.185,00 €