- Suchergebnis für GeneID 116541
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 116541" wurden 19 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: CSB-PA003303.50
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Schlagworte: | Anti-L54mt, Anti-MRPL54, Anti-MRP-L54, Anti-39S ribosomal protein L54, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Anwendung: | ELISA, WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
126,00 €
Artikelnummer: ATA-HPA042117.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 49% and to rat: 54%
| Schlagworte: | Anti-L54mt, Anti-MRPL54, Anti-MRP-L54, Anti-39S ribosomal protein L54, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
Artikelnummer: ATA-HPA046767.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 84% and to rat: 82%
| Schlagworte: | Anti-L54mt, Anti-MRPL54, Anti-MRP-L54, Anti-39S ribosomal protein L54, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Anwendung: | ICC, IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
Artikelnummer: CSB-EP014871HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 15-138aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: GWGAWELLNP ATSGRLLARD YAKKPVMKGA KSGKGAVTSE ALKDPDVCTD PVQLTTYAMG VNIYKEGQDV PLKPDAEYPE WLFEMNLGPP KTLEELDPES REYWRRLRKQ NIWRHNRLSK...
| Schlagworte: | L54mt, MRPL54, MRP-L54, 39S ribosomal protein L54, mitochondrial, Mitochondrial large ribosomal subunit protein mL54,... |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 18.2 kD |
ab 219,00 €
Artikelnummer: CSB-PA110296.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
| Schlagworte: | Anti-L54mt, Anti-MRPL54, Anti-MRP-L54, Anti-39S ribosomal protein L54, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Anwendung: | ELISA, WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
284,00 €
Artikelnummer: ABS-PP-10982-L.100
| Schlagworte: | Large ribosomal subunit protein mL54, 39S ribosomal protein L54, mitochondrial, L54mt, MRP-L54, Recombinant Human MRPL54... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 11 kD |
ab 115,00 €
Artikelnummer: 038601.200
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes,...
| Schlagworte: | Anti-L54mt, Anti-MRPL54, Anti-MRP-L54, Anti-39S ribosomal protein L54, mitochondrial |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
865,00 €
Artikelnummer: 374272.100
Source:, Recombinant protein corresponding to aa15-138 from human MRPL54, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~18.2kD, AA Sequence: GWGAWELLNPATSGRLLARDYAKKPVMKGAKSGKGAVTSEALKDPDVCTDPVQLTTYAMGVNIYKEGQDVPLKPDAEYPEWLFEMNLGPPKTLEELDPESREYWRRLRKQNIWRHNRLSKNKRL, Storage and Stability:...
| Schlagworte: | L54mt, MRPL54, MRP-L54, 39S ribosomal protein L54, mitochondrial, Mitochondrial large ribosomal subunit protein mL54 |
| MW: | 18,2 |
ab 603,00 €
Artikelnummer: ATA-APrEST82828.100
Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | L54mt, MRPL54, MRP-L54, 39S ribosomal protein L54, mitochondrial, Mitochondrial large ribosomal subunit protein mL54 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: ATA-APrEST82829.100
Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | L54mt, MRPL54, MRP-L54, 39S ribosomal protein L54, mitochondrial, Mitochondrial large ribosomal subunit protein mL54 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: G-CAB14957.20
MRPL54 Rabbit Polyclonal Antibody from Assay Genie with reactivity against Human and for use in WB IHC applications.MRPL54 Rabbit Polyclonal Antibody is an IgG isotype antibody and produced in Rabbit and purified by Affinity purification from Assay Genie.
| Schlagworte: | Anti-L54mt, Anti-MRPL54, Anti-MRP-L54, Anti-39S ribosomal protein L54, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Anwendung: | WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
103,00 €
Artikelnummer: ABD-8C14052.50
Custom conjugation services for this antibody as available (eg. labeling of Anti-MRPL54 with HRP. Available labels are AF: AF350, AF488, AF555, AF594, AF647, AF680, AF700, AF750. Proteins: HRP, Alkaline Phosphatase, Streptavidin. Tandems: APC, APC/Cy7, APC/AF750, APC/iFluor(TM) 700, APC/iFluor(TM) 750, PE, PE/Cy5,...
| Schlagworte: | Anti-L54mt, Anti-MRPL54, Anti-MRP-L54, Anti-39S ribosomal protein L54, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Anwendung: | WB, IHC, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
628,00 €