Zu "GeneID 116541" wurden 20 Artikel gefunden!

1 von 2 Seiten
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-MRPL54
Anti-MRPL54

Artikelnummer: CSB-PA003303.50

Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
Schlagworte: Anti-L54mt, Anti-MRPL54, Anti-MRP-L54, Anti-39S ribosomal protein L54, mitochondrial, Anti-Mitochondrial large ribosomal...
Anwendung: ELISA, WB, IHC
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
126,00 €
Bewerten
Anti-MRPL54
Anti-MRPL54

Artikelnummer: ATA-HPA042117.100

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 49% and to rat: 54%
Schlagworte: Anti-L54mt, Anti-MRPL54, Anti-MRP-L54, Anti-39S ribosomal protein L54, mitochondrial, Anti-Mitochondrial large ribosomal...
Anwendung: IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 369,00 €
Bewerten
Anti-MRPL54
Anti-MRPL54

Artikelnummer: ATA-HPA046767.100

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 84% and to rat: 82%
Schlagworte: Anti-L54mt, Anti-MRPL54, Anti-MRP-L54, Anti-39S ribosomal protein L54, mitochondrial, Anti-Mitochondrial large ribosomal...
Anwendung: ICC, IHC, WB
Wirt: Rabbit
Spezies-Reaktivität: human
ab 369,00 €
Bewerten
39S ribosomal protein L54, mitochondrial (MRPL54), human, recombinant
39S ribosomal protein L54, mitochondrial (MRPL54), human,...

Artikelnummer: CSB-EP014871HU.1

Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 15-138aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: GWGAWELLNP ATSGRLLARD YAKKPVMKGA KSGKGAVTSE ALKDPDVCTD PVQLTTYAMG VNIYKEGQDV PLKPDAEYPE WLFEMNLGPP KTLEELDPES REYWRRLRKQ NIWRHNRLSK...
Schlagworte: L54mt, MRPL54, MRP-L54, 39S ribosomal protein L54, mitochondrial, Mitochondrial large ribosomal subunit protein mL54,...
Anwendung: Activity not tested
Exprimiert in: E.coli
Ursprungsart: human
MW: 18.2 kD
ab 219,00 €
Bewerten
Anti-MRPL54
Anti-MRPL54

Artikelnummer: CSB-PA110296.100

Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
Schlagworte: Anti-L54mt, Anti-MRPL54, Anti-MRP-L54, Anti-39S ribosomal protein L54, mitochondrial, Anti-Mitochondrial large ribosomal...
Anwendung: ELISA, WB, IHC
Wirt: Rabbit
Spezies-Reaktivität: human
284,00 €
Bewerten
Anti-MRPL54
Anti-MRPL54

Artikelnummer: E-AB-65164.120

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes,...
Schlagworte: Anti-L54mt, Anti-MRPL54, Anti-MRP-L54, Anti-39S ribosomal protein L54, mitochondrial, Anti-Mitochondrial large ribosomal...
Anwendung: WB
Wirt: Rabbit
Spezies-Reaktivität: human
ab 243,00 €
Bewerten
Anti-MRPL54, ID (MRPL54, 39S ribosomal protein L54, mitochondrial)
Anti-MRPL54, ID (MRPL54, 39S ribosomal protein L54,...

Artikelnummer: 038601.200

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes,...
Schlagworte: Anti-L54mt, Anti-MRPL54, Anti-MRP-L54, Anti-39S ribosomal protein L54, mitochondrial
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: human
865,00 €
Bewerten
MRPL54, Recombinant, Human, aa15-138, His-Tag (39S Ribosomal Protein L54, Mitochondrial)
MRPL54, Recombinant, Human, aa15-138, His-Tag (39S...

Artikelnummer: 374272.1

Source:, Recombinant protein corresponding to aa15-138 from human MRPL54, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~18.2kD, AA Sequence: GWGAWELLNPATSGRLLARDYAKKPVMKGAKSGKGAVTSEALKDPDVCTDPVQLTTYAMGVNIYKEGQDVPLKPDAEYPEWLFEMNLGPPKTLEELDPESREYWRRLRKQNIWRHNRLSKNKRL, Storage and Stability:...
Schlagworte: L54mt, MRPL54, MRP-L54, 39S ribosomal protein L54, mitochondrial, Mitochondrial large ribosomal subunit protein mL54
MW: 18,2
ab 603,00 €
Bewerten
MRPL54 PrEST Antigen
MRPL54 PrEST Antigen

Artikelnummer: ATA-APrEST82828.100

Buffer: PBS and 1M Urea, pH 7.4.
Schlagworte: L54mt, MRPL54, MRP-L54, 39S ribosomal protein L54, mitochondrial, Mitochondrial large ribosomal subunit protein mL54
Anwendung: Control antigen
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
MRPL54 PrEST Antigen
MRPL54 PrEST Antigen

Artikelnummer: ATA-APrEST82829.100

Buffer: PBS and 1M Urea, pH 7.4.
Schlagworte: L54mt, MRPL54, MRP-L54, 39S ribosomal protein L54, mitochondrial, Mitochondrial large ribosomal subunit protein mL54
Anwendung: Control antigen
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
Anti-MRPL54
Anti-MRPL54

Artikelnummer: G-CAB14957.100

WB 1:500 - 1:2000.
Schlagworte: Anti-L54mt, Anti-MRPL54, Anti-MRP-L54, Anti-39S ribosomal protein L54, mitochondrial, Anti-Mitochondrial large ribosomal...
Anwendung: WB
Wirt: Rabbit
Spezies-Reaktivität: human
ab 103,00 €
Bewerten
Anti-MRPL54
Anti-MRPL54

Artikelnummer: ABD-8C14052.50

Custom conjugation services for this antibody as available (eg. labeling of Anti-MRPL54 with HRP. Available labels are AF: AF350, AF488, AF555, AF594, AF647, AF680, AF700, AF750. Proteins: HRP, Alkaline Phosphatase, Streptavidin. Tandems: APC, APC/Cy7, APC/AF750, APC/iFluor(TM) 700, APC/iFluor(TM) 750, PE, PE/Cy5,...
Schlagworte: Anti-L54mt, Anti-MRPL54, Anti-MRP-L54, Anti-39S ribosomal protein L54, mitochondrial, Anti-Mitochondrial large ribosomal...
Anwendung: WB, IHC, ELISA
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
628,00 €
Bewerten
1 von 2 Seiten