Zu "GeneID 11341" wurden 18 Artikel gefunden!

1 von 2 Seiten
Für die Filterung wurden keine Ergebnisse gefunden!
Human SCRG1(Scrapie responsive protein 1) ELISA Kit
Human SCRG1(Scrapie responsive protein 1) ELISA Kit

Artikelnummer: G-HUFI03075.96

Schlagworte: SCRG1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein
698,00 €
Bewerten
Anti-SCRG1
Anti-SCRG1

Artikelnummer: G-PACO35186.50

SCRG1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC applications. SCRG1 Antibody is a high quality polyclonal antibody for research use only.
Schlagworte: Anti-SCRG1, Anti-ScRG-1, Anti-Scrapie-responsive protein 1, Anti-Scrapie-responsive gene 1 protein
Anwendung: ELISA, IHC
Wirt: Rabbit
Spezies-Reaktivität: human
313,00 €
Bewerten
Anti-SCRG1
Anti-SCRG1

Artikelnummer: ATA-HPA012882.100

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 89% and to rat: 86%
Schlagworte: Anti-SCRG1, Anti-ScRG-1, Anti-Scrapie-responsive protein 1, Anti-Scrapie-responsive gene 1 protein
Anwendung: IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 246,00 €
Bewerten
Scrapie-responsive protein 1 (SCRG1), human, recombinant
Scrapie-responsive protein 1 (SCRG1), human, recombinant

Artikelnummer: CSB-YP530448HU.1

Organism: Homo sapiens (Human). Source: Yeast. Expression Region: 21-98aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: MPANRLSCYR KILKDHNCHN LPEGVADLTQ IDVNVQDHFW DGKGCEMICY CNFSELLCCP KDVFFGPKIS FVIPCNNQ. Purity: Greater than 90% as determined by...
Schlagworte: SCRG1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein, Recombinant Human Scrapie-responsive...
Anwendung: Activity not tested
Exprimiert in: Yeast
Ursprungsart: human
MW: 10.9 kD
ab 242,00 €
Bewerten
Scrapie-responsive protein 1 (SCRG1), human, recombinant
Scrapie-responsive protein 1 (SCRG1), human, recombinant

Artikelnummer: CSB-EP530448HU.1

Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 21-98aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: MPANRLSCYR KILKDHNCHN LPEGVADLTQ IDVNVQDHFW DGKGCEMICY CNFSELLCCP KDVFFGPKIS FVIPCNNQ. Purity: Greater than 90% as determined by...
Schlagworte: SCRG1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein, Recombinant Human Scrapie-responsive...
Anwendung: Activity not tested
Exprimiert in: E.coli
Ursprungsart: human
MW: 24.9 kD
ab 219,00 €
Bewerten
Scrapie-responsive protein 1 (SCRG1), human, recombinant
Scrapie-responsive protein 1 (SCRG1), human, recombinant

Artikelnummer: CSB-EP530448HUa0.1

Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 21-98aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: MPANRLSCYR KILKDHNCHN LPEGVADLTQ IDVNVQDHFW DGKGCEMICY CNFSELLCCP KDVFFGPKIS FVIPCNNQ. Purity: Greater than 85% as determined by...
Schlagworte: SCRG1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein, Recombinant Human Scrapie-responsive...
Anwendung: Activity not tested
Exprimiert in: E.coli
Ursprungsart: human
MW: 12.9 kD
ab 219,00 €
Bewerten
SCRG1 Protein, Human, Recombinant (His & SUMO)
SCRG1 Protein, Human, Recombinant (His & SUMO)

Artikelnummer: TGM-TMPH-02064-100ug

Description: SCRG1 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli.
Schlagworte: Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein, SCRG1
MW: 24.9 kD
ab 187,00 €
Bewerten
SCRG1 Protein, Human, Recombinant (His & SUMO)
SCRG1 Protein, Human, Recombinant (His & SUMO)

Artikelnummer: TGM-TMPH-02064-10ug

Description: SCRG1 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli.
Schlagworte: SCRG1 , Scrapie-responsive gene 1 protein (ScRG-1) , Scrapie-responsive protein 1
MW: 24.9 kD
ab 71,00 €
Bewerten
SCRG1, Human stimulator of chondrogenesis 1, Real Time PCR Primer Set
SCRG1, Human stimulator of chondrogenesis 1, Real Time...

Artikelnummer: VHPS-8168

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Schlagworte: SCRG1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein
Anwendung: RNA quantification
45,00 €
Bewerten
SCRG1, Recombinant, Human, aa21-98, His-SUMO-Tag (Scrapie-responsive Protein 1)
SCRG1, Recombinant, Human, aa21-98, His-SUMO-Tag...

Artikelnummer: 375225.1

Source:, Recombinant protein corresponding to aa21-98 from human SCRG1, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~24.9kD, AA Sequence: MPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNQ, Storage and Stability: May be stored at 4°C for short-term only....
Schlagworte: SCRG1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein
MW: 24,9
ab 603,00 €
Bewerten
Scrapie-Responsive Protein 1, Recombinant, Human, aa21-98, His-Tag (SCRG1)
Scrapie-Responsive Protein 1, Recombinant, Human,...

Artikelnummer: 518100.1

Source:, Recombinant protein corresponding to aa21-98 of human Scrapie-Responsive Protein 1, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~12.9kD, AA Sequence: MPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNQ, Storage and Stability: May be stored at 4°C for...
Schlagworte: SCRG1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein
Exprimiert in: E.coli
Ursprungsart: human
MW: 12.9 kD
ab 603,00 €
Bewerten
SCRG1 PrEST Antigen
SCRG1 PrEST Antigen

Artikelnummer: ATA-APrEST72151.100

Buffer: PBS and 1M Urea, pH 7.4.
Schlagworte: SCRG1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein
Anwendung: Control antigen
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
1 von 2 Seiten