Zu "GeneID 112858" wurden 11 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-TP53RK
Artikelnummer: ATA-HPA015837.100
Protein function: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine (PubMed:22912744, PubMed:27903914). The complex is probably involved in the transfer of the threonylcarbamoyl...
| Schlagworte: | Anti-Nori-2, Anti-C20orf64, Anti-TP53-regulating kinase, Anti-p53-related protein kinase, Anti-EKC/KEOPS complex subunit... |
| Anwendung: | WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Anti-TP53RK
Artikelnummer: ATA-HPA075054.100
Polyclonal Antibody against Human TP53RK, Gene description: TP53 regulating kinase, Alternative Gene Names: BUD32, C20orf64, dJ101A2.2, Nori-2p, prpk, TPRKB, Validated applications: IHC, WB, Uniprot ID: Q96S44, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein...
| Schlagworte: | Anti-Nori-2, Anti-C20orf64, Anti-TP53-regulating kinase, Anti-p53-related protein kinase, Anti-EKC/KEOPS complex subunit... |
| Anwendung: | WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
TP53RK (human), recombinant protein
Artikelnummer: ABS-PP-12434-L.100
Protein function: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine (PubMed:22912744, PubMed:27903914). The complex is probably involved in the transfer of the threonylcarbamoyl...
| Schlagworte: | EKC/KEOPS complex subunit TP53RK, Atypical serine/threonine protein kinase TP53RK, Nori-2, TP53-regulating kinase,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 29 kD |
ab 115,00 €
TP53RK protein-GST fusion
Artikelnummer: 009-001-U16S
Recombinant full-length human TP53RK was expressed by baculovirus in Sf9 insect cells using an N-Terminal Glutathione-S-Transferase fusion protein. The purity was determined to be >80% by densitometry. Protein function: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl...
| Schlagworte: | TP53RK, Nori-2, C20orf64, EC=3.6.-.-, EC=2.7.11.1, TP53-regulating kinase, p53-related protein kinase, EKC/KEOPS complex... |
| Anwendung: | WB |
| Exprimiert in: | Human |
497,00 €
Anti-TP53RK, CT (TP53RK, C20orf64, PRPK, TP53-regulating...
Artikelnummer: 043147.200
Protein kinase that phosphorylates 'Ser-15' of p53/TP53 protein and may therefore participate in its activation. Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid...
| Schlagworte: | Anti-TP53RK, Anti-Nori-2, Anti-C20orf64, EC=3.6.-.-, EC=2.7.11.1, Anti-TP53-regulating kinase, Anti-p53-related protein... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
865,00 €
Anti-PRPK, ID (TP53-regulating Kinase, p53-related...
Artikelnummer: P9120-90.200
Protein kinases are enzymes that transfer a phosphate group from a phosphate donor, generally the g phosphate of ATP, onto an acceptor amino acid in a substrate protein. By this basic mechanism, protein kinases mediate most of the signal transduction in eukaryotic cells, regulating cellular metabolism,...
| Schlagworte: | EC=2.7.11.1, Anti-TP53-regulating kinase, Anti-p53-related protein kinase |
| Anwendung: | ELISA, IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
865,00 €
TP53RK PrEST Antigen
Artikelnummer: ATA-APrEST71455.100
Protein function: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine (PubMed:22912744, PubMed:27903914). The complex is probably involved in the transfer of the threonylcarbamoyl...
| Schlagworte: | Nori-2, C20orf64, TP53-regulating kinase, p53-related protein kinase, EKC/KEOPS complex subunit TP53RK, Atypical... |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Anti-TP53RK
Artikelnummer: G-CAB14952.20
Protein function: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine (PubMed:22912744, PubMed:27903914). The complex is probably involved in the transfer of the threonylcarbamoyl...
| Schlagworte: | Anti-Nori-2, Anti-C20orf64, Anti-TP53-regulating kinase, Anti-p53-related protein kinase, Anti-EKC/KEOPS complex subunit... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
103,00 €
TP53RK (Vector pUC, Accession No. BC009727)
Artikelnummer: CSB-CL822302HU.10
Length: 762 Sequence: atggcggcgg ccagagctac tacgccggcc gatggcgagg agcccgcccc ggaggctgag gctctggccg cagcccggga gcggagcagc cgcttcttga gcggcctgga gctggtgaag cagggtgccg aggcgcgcgt gttccgtggc cgcttccagg gccgcgcggc ggtgatcaag caccgcttcc ccaagggcta ccggcacccg gcgctggagg cgcggcttgg cagacggcgg acggtgcagg aggcccgggc...
| Schlagworte: | Nori-2, C20orf64, TP53-regulating kinase, p53-related protein kinase, EKC/KEOPS complex subunit TP53RK, Atypical... |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
290,00 €
TP53RK (human), recombinant protein
Artikelnummer: ABS-PP-12434.100
Protein function: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine (PubMed:22912744, PubMed:27903914). The complex is probably involved in the transfer of the threonylcarbamoyl...
| Schlagworte: | EKC/KEOPS complex subunit TP53RK, Atypical serine/threonine protein kinase TP53RK, Nori-2, TP53-regulating kinase,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 29 kD |
ab 90,00 €
TP53RK PrEST Antigen
Artikelnummer: ATA-APrEST95777.100
PrEST Antigen TP53RK, Gene description: TP53 regulating kinase, Alternative Gene Names: BUD32, C20orf64, dJ101A2.2, Nori-2p, prpk, TPRKB, Antigen sequence: FGLSFISALPEDKGVDLYVLEKAFLSTHPNTETVFEAFLKSYSTSSKKARPVLKKLDEVRLRGRKRSMVG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
| Schlagworte: | Nori-2, C20orf64, TP53-regulating kinase, p53-related protein kinase, EKC/KEOPS complex subunit TP53RK, Atypical... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €