- Suchergebnis für GeneID 10882
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 10882" wurden 8 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA071349.100
Polyclonal Antibody against Human C1QL1, Gene description: complement C1q like 1, Alternative Gene Names: C1QRF, C1QTNF14, CRF, CTRP14, Validated applications: ICC, Uniprot ID: O75973, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May regulate the number...
| Schlagworte: | Anti-C1QRF, Anti-C1QL1, Anti-C1q-related factor, Anti-C1q/TNF-related protein 14, Anti-Complement component 1 Q... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
NEU
Artikelnummer: ATA-HPA071349.25
Polyclonal Antibody against Human C1QL1, Gene description: complement C1q like 1, Alternative Gene Names: C1QRF, C1QTNF14, CRF, CTRP14, Validated applications: ICC, Uniprot ID: O75973, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May regulate the number...
| Schlagworte: | Anti-C1QRF, Anti-C1QL1, Anti-C1q-related factor, Anti-C1q/TNF-related protein 14, Anti-Complement component 1 Q... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
361,00 €
Artikelnummer: G-AEKE04566.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human C1qL1. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human C1qL1. Next,...
| Schlagworte: | C1QL1, C1q-related factor, Complement component 1 Q subcomponent-like 1, C1q and tumor necrosis factor-related protein 14 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
694,00 €
Artikelnummer: ELK-ELK10555.48
May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses (By similarity) Assay Type: Sandwich. Sensitivity: 1.29 ng/mL. Standard: 200 ng/mL. Detection range: 3.13-200 ng/mL. Sample type: Serum, plasma and other biological fluids.. Assay length: 3.5h....
| Schlagworte: | C1QL1, C1q-related factor, Complement component 1 Q subcomponent-like 1, C1q and tumor necrosis factor-related protein 14 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | human |
ab 374,00 €
Artikelnummer: ABS-PP-25878-L.100
Protein function: May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses. [The UniProt Consortium]
| Schlagworte: | C1QRF, C1QL1, C1q-related factor, C1q/TNF-related protein 14, Complement component 1 Q subcomponent-like 1, C1q and tumor... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 26 kD |
ab 115,00 €
Artikelnummer: ABS-PP-25878.100
Protein function: May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses. [The UniProt Consortium]
| Schlagworte: | C1QRF, C1QL1, C1q-related factor, C1q/TNF-related protein 14, Complement component 1 Q subcomponent-like 1, C1q and tumor... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 26 kD |
ab 90,00 €
Artikelnummer: 024337.96
Complement Component 1, Q Subcomponent Like Protein 1 (C1qL1) BioAssay(TM) ELISA Kit (Human) is a sandwich enzyme immunoassay for the in vitro quantitative measurement of C1QL1 in human serum, plasma and other biological fluids. Detection Range: 0.156-10ng/ml, Sensitivity: 0.053ng/ml, Storage and Stability:...
| Schlagworte: | C1QL1, C1QRF, C1q-related factor, C1q/TNF-related protein 14, Complement component 1 Q subcomponent-like 1, C1q and tumor... |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | human |
1.128,00 €
Artikelnummer: ATA-APrEST95738.100
PrEST Antigen C1QL1, Gene description: complement C1q like 1, Alternative Gene Names: C1QRF, C1QTNF14, CRF, CTRP14, Antigen sequence: YHVLMRGGDGTSMWADLCKNGQVRASAIAQDADQNYDYASNSV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May regulate the number of excitatory synapses...
| Schlagworte: | C1QRF, C1QL1, C1q-related factor, C1q/TNF-related protein 14, Complement component 1 Q subcomponent-like 1, C1q and tumor... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €