Zu "GeneID 10882" wurden 7 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-C1QL1
Artikelnummer: ATA-HPA071349.100
Polyclonal Antibody against Human C1QL1, Gene description: complement C1q like 1, Alternative Gene Names: C1QRF, C1QTNF14, CRF, CTRP14, Validated applications: ICC, Uniprot ID: O75973, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May regulate the number...
| Schlagworte: | Anti-C1QRF, Anti-C1QL1, Anti-C1q-related factor, Anti-C1q/TNF-related protein 14, Anti-Complement component 1 Q... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Human C1qL1 (Complement Component 1, Q Subcomponent Like...
Artikelnummer: G-AEKE04566.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human C1qL1. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human C1qL1. Next,...
| Schlagworte: | C1QL1, C1q-related factor, Complement component 1 Q subcomponent-like 1, C1q and tumor necrosis factor-related protein 14 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
694,00 €
Human C1qL1(Complement Component 1, Q Subcomponent Like...
Artikelnummer: ELK-ELK10555.48
May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses (By similarity) Assay Type: Sandwich. Sensitivity: 1.29 ng/mL. Standard: 200 ng/mL. Detection range: 3.13-200 ng/mL. Sample type: Serum, plasma and other biological fluids.. Assay length: 3.5h....
| Schlagworte: | C1QL1, C1q-related factor, Complement component 1 Q subcomponent-like 1, C1q and tumor necrosis factor-related protein 14 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | human |
ab 374,00 €
C1QL1 (human), recombinant protein
Artikelnummer: ABS-PP-25878-L.100
Protein function: May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses. [The UniProt Consortium]
| Schlagworte: | C1QRF, C1QL1, C1q-related factor, C1q/TNF-related protein 14, Complement component 1 Q subcomponent-like 1, C1q and tumor... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 26 kD |
ab 115,00 €
C1QL1 (human), recombinant protein
Artikelnummer: ABS-PP-25878.100
Protein function: May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses. [The UniProt Consortium]
| Schlagworte: | C1QRF, C1QL1, C1q-related factor, C1q/TNF-related protein 14, Complement component 1 Q subcomponent-like 1, C1q and tumor... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 26 kD |
ab 90,00 €
Complement Component 1, Q Subcomponent Like Protein 1...
Artikelnummer: 024337.96
Complement Component 1, Q Subcomponent Like Protein 1 (C1qL1) BioAssay(TM) ELISA Kit (Human) is a sandwich enzyme immunoassay for the in vitro quantitative measurement of C1QL1 in human serum, plasma and other biological fluids. Detection Range: 0.156-10ng/ml, Sensitivity: 0.053ng/ml, Storage and Stability:...
| Schlagworte: | C1QL1, C1QRF, C1q-related factor, C1q/TNF-related protein 14, Complement component 1 Q subcomponent-like 1, C1q and tumor... |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | human |
1.128,00 €
C1QL1 PrEST Antigen
Artikelnummer: ATA-APrEST95738.100
PrEST Antigen C1QL1, Gene description: complement C1q like 1, Alternative Gene Names: C1QRF, C1QTNF14, CRF, CTRP14, Antigen sequence: YHVLMRGGDGTSMWADLCKNGQVRASAIAQDADQNYDYASNSV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May regulate the number of excitatory synapses...
| Schlagworte: | C1QRF, C1QL1, C1q-related factor, C1q/TNF-related protein 14, Complement component 1 Q subcomponent-like 1, C1q and tumor... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €