Zu "GeneID 10053" wurden 12 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
Anti-AP1M2
Anti-AP1M2

Artikelnummer: ARG41196.100

Protein function: Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo...
Schlagworte: Anti-AP1M2, Anti-Mu1B-adaptin, Anti-Mu-adaptin 2, Anti-AP-1 complex subunit mu-2, Anti-AP-mu chain family member mu1B,...
Anwendung: IHC (paraffin), WB
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
707,00 €
Bewerten
Anti-AP1M2
Anti-AP1M2

Artikelnummer: ATA-HPA054999.100

Protein function: Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo...
Schlagworte: Anti-AP1M2, Anti-Mu1B-adaptin, Anti-Mu-adaptin 2, Anti-AP-1 complex subunit mu-2, Anti-AP-mu chain family member mu1B,...
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 246,00 €
Bewerten
Anti-AP1M2
Anti-AP1M2

Artikelnummer: ATA-HPA077258.100

Polyclonal Antibody against Human AP1M2, Gene description: adaptor related protein complex 1 subunit mu 2, Alternative Gene Names: AP1-mu2, HSMU1B, mu2, Validated applications: ICC, WB, Uniprot ID: Q9Y6Q5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
Schlagworte: Anti-AP1M2, Anti-Mu1B-adaptin, Anti-Mu-adaptin 2, Anti-AP-1 complex subunit mu-2, Anti-AP-mu chain family member mu1B,...
Anwendung: WB, ICC
Wirt: Rabbit
Spezies-Reaktivität: human
491,00 €
Bewerten
AP1M2 (human), recombinant protein
AP1M2 (human), recombinant protein

Artikelnummer: ABS-PP-6598-L.100

Protein function: Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo...
Schlagworte: AP-1 complex subunit mu-2, AP-mu chain family member mu1B, Adaptor protein complex AP-1 subunit mu-2, Adaptor-related...
Exprimiert in: E.coli
Ursprungsart: human
MW: 16.5 kD
ab 115,00 €
Bewerten
AP1M2, Human adaptor-related protein complex 1, mu 2 subunit, Real Time PCR Primer Set
AP1M2, Human adaptor-related protein complex 1, mu 2...

Artikelnummer: VHPS-413

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Schlagworte: AP1M2, Mu-adaptin 2, Mu1B-adaptin, AP-1 complex subunit mu-2, AP-mu chain family member mu1B, Adaptor protein complex AP-1...
Anwendung: RNA quantification
45,00 €
Bewerten
AP1M2 PrEST Antigen
AP1M2 PrEST Antigen

Artikelnummer: ATA-APrEST91602.100

Protein function: Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo...
Schlagworte: AP1M2, Mu1B-adaptin, Mu-adaptin 2, AP-1 complex subunit mu-2, AP-mu chain family member mu1B, Adaptor protein complex AP-1...
Anwendung: Control antigen
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
Anti-AP1M2
Anti-AP1M2

Artikelnummer: ELK-ES18311.100

This gene encodes a subunit of the heterotetrameric adaptor-related protein comlex 1 (AP-1), which belongs to the adaptor complexes medium subunits family. This protein is capable of interacting with tyrosine-based sorting signals. Alternative splicing results in multiple transcript variants. [provided by RefSeq,...
Schlagworte: Anti-AP1M2, Anti-Mu1B-adaptin, Anti-Mu-adaptin 2, Anti-AP-1 complex subunit mu-2, Anti-AP-mu chain family member mu1B,...
Anwendung: WB
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
ab 173,00 €
Bewerten
Human AP1M2 (AP-1 complex subunit mu-2) ELISA Kit
Human AP1M2 (AP-1 complex subunit mu-2) ELISA Kit

Artikelnummer: G-AEFI00330.96

ELISA Type: Sandwich ELISA, Double Antibody. Detection Range: 15.625-1000µg/mL. Sensitivity: 9.375µg/mL. Sample Types: Serum, Plasma, Cell Culture Supernatant, cell or tissue lysate, Other liquid samples. Protein function: Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting...
Schlagworte: AP1M2, Mu1B-adaptin, Mu-adaptin 2, AP-1 complex subunit mu-2, AP-mu chain family member mu1B, Adaptor protein complex AP-1...
Anwendung: Sandwich ELISA, Double Antibody
Spezies-Reaktivität: human
698,00 €
Bewerten
Anti-AP1M2
Anti-AP1M2

Artikelnummer: CSB-PA001865GA01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: AP1M2. Antigen Species: Human
Schlagworte: Anti-AP1M2, Anti-Mu1B-adaptin, Anti-Mu-adaptin 2, Anti-AP-1 complex subunit mu-2, Anti-AP-mu chain family member mu1B,...
Anwendung: ELISA, IHC
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
552,00 €
Bewerten
Anti-AP1M2
Anti-AP1M2

Artikelnummer: CSB-PA895771ESR1HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: AP1M2. Antigen Species: Human
Schlagworte: Anti-AP1M2, Anti-Mu1B-adaptin, Anti-Mu-adaptin 2, Anti-AP-1 complex subunit mu-2, Anti-AP-mu chain family member mu1B,...
Anwendung: ELISA, WB, IHC
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
ab 167,00 €
Bewerten
AP1M2 (human), recombinant protein
AP1M2 (human), recombinant protein

Artikelnummer: ABS-PP-6598.100

Protein function: Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo...
Schlagworte: AP-1 complex subunit mu-2, AP-mu chain family member mu1B, Adaptor protein complex AP-1 subunit mu-2, Adaptor-related...
Exprimiert in: E.coli
Ursprungsart: human
MW: 16.5 kD
ab 90,00 €
Bewerten
AP1M2 PrEST Antigen
AP1M2 PrEST Antigen

Artikelnummer: ATA-APrEST96203.100

PrEST Antigen AP1M2, Gene description: adaptor related protein complex 1 subunit mu 2, Alternative Gene Names: AP1-mu2, HSMU1B, mu2, Antigen sequence: PYFTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLRTS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Subunit of clathrin-associated...
Schlagworte: AP1M2, Mu1B-adaptin, Mu-adaptin 2, AP-1 complex subunit mu-2, AP-mu chain family member mu1B, Adaptor protein complex AP-1...
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten