- Suchergebnis für GeneID 10053
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 10053" wurden 13 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ARG41196.100
Protein function: Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo...
| Schlagworte: | Anti-AP1M2, Anti-Mu1B-adaptin, Anti-Mu-adaptin 2, Anti-AP-1 complex subunit mu-2, Anti-AP-mu chain family member mu1B,... |
| Anwendung: | IHC (paraffin), WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
707,00 €
Artikelnummer: ATA-HPA054999.100
Protein function: Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo...
| Schlagworte: | Anti-AP1M2, Anti-Mu1B-adaptin, Anti-Mu-adaptin 2, Anti-AP-1 complex subunit mu-2, Anti-AP-mu chain family member mu1B,... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Artikelnummer: ATA-HPA077258.100
Polyclonal Antibody against Human AP1M2, Gene description: adaptor related protein complex 1 subunit mu 2, Alternative Gene Names: AP1-mu2, HSMU1B, mu2, Validated applications: ICC, WB, Uniprot ID: Q9Y6Q5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
| Schlagworte: | Anti-AP1M2, Anti-Mu1B-adaptin, Anti-Mu-adaptin 2, Anti-AP-1 complex subunit mu-2, Anti-AP-mu chain family member mu1B,... |
| Anwendung: | WB, ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: ATA-HPA077258.25
Polyclonal Antibody against Human AP1M2, Gene description: adaptor related protein complex 1 subunit mu 2, Alternative Gene Names: AP1-mu2, HSMU1B, mu2, Validated applications: ICC, WB, Uniprot ID: Q9Y6Q5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
| Schlagworte: | Anti-AP1M2, Anti-Mu1B-adaptin, Anti-Mu-adaptin 2, Anti-AP-1 complex subunit mu-2, Anti-AP-mu chain family member mu1B,... |
| Anwendung: | WB, ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
361,00 €
Artikelnummer: VHPS-413
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | AP1M2, Mu-adaptin 2, Mu1B-adaptin, AP-1 complex subunit mu-2, AP-mu chain family member mu1B, Adaptor protein complex AP-1... |
| Anwendung: | RNA quantification |
45,00 €
Artikelnummer: ATA-APrEST91602.100
Protein function: Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo...
| Schlagworte: | AP1M2, Mu1B-adaptin, Mu-adaptin 2, AP-1 complex subunit mu-2, AP-mu chain family member mu1B, Adaptor protein complex AP-1... |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: ELK-ES18311.100
This gene encodes a subunit of the heterotetrameric adaptor-related protein comlex 1 (AP-1), which belongs to the adaptor complexes medium subunits family. This protein is capable of interacting with tyrosine-based sorting signals. Alternative splicing results in multiple transcript variants. [provided by RefSeq,...
| Schlagworte: | Anti-AP1M2, Anti-Mu1B-adaptin, Anti-Mu-adaptin 2, Anti-AP-1 complex subunit mu-2, Anti-AP-mu chain family member mu1B,... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 173,00 €
Artikelnummer: G-AEFI00330.96
ELISA Type: Sandwich ELISA, Double Antibody. Detection Range: 15.625-1000µg/mL. Sensitivity: 9.375µg/mL. Sample Types: Serum, Plasma, Cell Culture Supernatant, cell or tissue lysate, Other liquid samples. Protein function: Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting...
| Schlagworte: | AP1M2, Mu1B-adaptin, Mu-adaptin 2, AP-1 complex subunit mu-2, AP-mu chain family member mu1B, Adaptor protein complex AP-1... |
| Anwendung: | Sandwich ELISA, Double Antibody |
| Spezies-Reaktivität: | human |
698,00 €
Artikelnummer: CSB-PA001865GA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: AP1M2. Antigen Species: Human
| Schlagworte: | Anti-AP1M2, Anti-Mu1B-adaptin, Anti-Mu-adaptin 2, Anti-AP-1 complex subunit mu-2, Anti-AP-mu chain family member mu1B,... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
552,00 €
Artikelnummer: CSB-PA895771ESR1HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: AP1M2. Antigen Species: Human
| Schlagworte: | Anti-AP1M2, Anti-Mu1B-adaptin, Anti-Mu-adaptin 2, Anti-AP-1 complex subunit mu-2, Anti-AP-mu chain family member mu1B,... |
| Anwendung: | ELISA, WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 167,00 €
Artikelnummer: ABS-PP-6598.100
Protein function: Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo...
| Schlagworte: | AP-1 complex subunit mu-2, AP-mu chain family member mu1B, Adaptor protein complex AP-1 subunit mu-2, Adaptor-related... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 16.5 kD |
ab 90,00 €
Artikelnummer: ATA-APrEST96203.100
PrEST Antigen AP1M2, Gene description: adaptor related protein complex 1 subunit mu 2, Alternative Gene Names: AP1-mu2, HSMU1B, mu2, Antigen sequence: PYFTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLRTS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Subunit of clathrin-associated...
| Schlagworte: | AP1M2, Mu1B-adaptin, Mu-adaptin 2, AP-1 complex subunit mu-2, AP-mu chain family member mu1B, Adaptor protein complex AP-1... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €