Zu "(comp.)" wurden 224 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-SCMH1 (Sex Comb on Midleg Homolog 1 (Drosophila),...
Artikelnummer: 207871.100
| Anwendung: | ELISA, WB |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human |
850,00 €
SCMH1, Human sex comb on midleg homolog 1 (Drosophila),...
Artikelnummer: VHPS-8150
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | SCMH1, Polycomb protein SCMH1, Sex comb on midleg homolog 1 |
| Anwendung: | RNA quantification |
45,00 €
Scmh1, Rat sex comb on midleg homolog 1 (Drosophila),...
Artikelnummer: VRPS-5428
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | Scmh1, rCG_31106, Scmh1 protein, Scmh1_predicted, Sex comb on midleg homolog 1 (Predicted) |
| Anwendung: | RNA quantification |
54,00 €
SCML1, Human sex comb on midleg-like 1 (Drosophila), Real...
Artikelnummer: VHPS-8151
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | SCML1, Sex comb on midleg-like protein 1 |
| Anwendung: | RNA quantification |
45,00 €
SCML2, Human sex comb on midleg-like 2 (Drosophila), Real...
Artikelnummer: VHPS-8152
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | SCML2, Sex comb on midleg-like protein 2 |
| Anwendung: | RNA quantification |
45,00 €
Scmh1, Mouse sex comb on midleg homolog 1, Real Time PCR...
Artikelnummer: VMPS-5703
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | Scmh1, Polycomb protein SCMH1, Sex comb on midleg homolog 1 |
| Anwendung: | RNA quantification |
45,00 €
Scml1, Mouse Vsex comb on midleg-like 1 (Drosophila),...
Artikelnummer: VMPS-5704
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | GeneID 195726, qPCR, gene expression analysis |
| Anwendung: | RNA quantification |
45,00 €
Anti-Sex Comb on Midleg-Like 2 (SCML2)
Artikelnummer: S1012-37.50
Putative Polycomb group (PcG) protein. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development (By similarity). Applications: Suitable for use in Western Blot amd Dot Blot. Other applications not tested....
| Schlagworte: | Anti-Sex comb on midleg-like protein 2 |
| Anwendung: | Dot Blot, WB |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human, mouse, rat |
557,00 €
Anti-SCMH1 (Sex Comb on Midleg Homolog 1, Polycomb...
Artikelnummer: 133016.100
Applications:, Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence:...
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
943,00 €
Anti-SCMH1 (Sex Comb on Midleg Homolog 1, Polycomb...
Artikelnummer: 133017.100
Applications:, Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EKLCHNLRSDNLFGNQPFTQTHLSLTAIEYSHSHDRYLPGETFVLGNSLARSLEPHSDSMDSASNPTNLVSTSQRHRPLLSSCGLPPSTASAVRRLCSR*, Storage and Stability: May be stored...
| Anwendung: | ELISA, WB |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human |
850,00 €
Anti-SCML1 (Sex comb on midleg-like 1 (Drosophila))
Artikelnummer: 251455.50
Mouse polyclonal antibody raised against a full-length human SCML1 protein. Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence:...
| Anwendung: | IF, WB |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human |
850,00 €
Anti-SCML1 (Sex Comb on Midleg-like Protein 1)
Artikelnummer: 133020.100
Putative Polycomb group (PcG) protein. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. May be involved in spermatogenesis during sexual maturation. Applications: Suitable for use in Western Blot. Other...
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
943,00 €