UBR1 PrEST Antigen

PrEST Antigen UBR1, Gene description: ubiquitin protein ligase E3 component n-recognin 1, Antigen sequence: LHTTAIDKEGRRAVKAGAYAACQEAKEDIKSHSENVSQHPLHVEVLHSEIMAHQKFALRLGSWMNKIMSYSSDFR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific N- terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation. May be involved in pancreatic homeostasis. Binds leucine and is a negative regulator of the leucine-mTOR signaling pathway, thereby controlling cell growth. [The UniProt Consortium] Mouse gene identity: 95% Rat gene identity: 95%