UBASH3B PrEST Antigen

UBASH3B PrEST Antigen
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ATA-APrEST95725.100 100 µl

7 - 10 Werktage*

264,00 €
 
PrEST Antigen UBASH3B, Gene description: ubiquitin associated and SH3 domain containing B,... mehr
Produktinformationen "UBASH3B PrEST Antigen"
PrEST Antigen UBASH3B, Gene description: ubiquitin associated and SH3 domain containing B, Alternative Gene Names: KIAA1959, STS-1, TULA-2, TULA2, Antigen sequence: YGTSLTTGCSGLLPENYITKADECSTWIFHGSYSILNTSSSNSLTFGDGVLERRPYEDQGLGETTPLTIICQPM, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Interferes with CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases. Promotes accumulation of activated target receptors, such as T-cell receptors and EGFR, on the cell surface. Exhibits tyrosine phosphatase activity toward several substrates including EGFR, FAK, SYK, and ZAP70. Down-regulates proteins that are dually modified by both protein tyrosine phosphorylation and ubiquitination. [The UniProt Consortium] Mouse gene identity: 93% Rat gene identity: 93%
Schlagworte: STS-1, TULA-2, UBASH3B, KIAA1959, EC=3.1.3.48, T-cell ubiquitin ligand 2, Cbl-interacting protein p70, Tyrosine-protein phosphatase STS1/TULA2, Suppressor of T-cell receptor signaling 1, Ubiquitin-associated and SH3 domain-containing protein B
Hersteller: Atlas Antibodies
Hersteller-Nr: APrEST95725

Eigenschaften

Konjugat: No
Wirt: E.coli
Spezies-Reaktivität: human
Format: Solution

Handhabung & Sicherheit

Lagerung: -20°C (avoid repeat freezing and thawing cycles)
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "UBASH3B PrEST Antigen"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen