UBASH3A PrEST Antigen

PrEST Antigen UBASH3A, Gene description: ubiquitin associated and SH3 domain containing A, Alternative Gene Names: CLIP4, STS-2, TULA, Antigen sequence: KSVLVVRHGERVDQIFGKAWLQQCSTPDGKYYRPDLNFPCSLPRRSRGIKDFENDPPLSSCGIFQSRIA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Interferes with CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases. Promotes accumulation of activated target receptors, such as T-cell receptors, EGFR and PDGFRB, on the cell surface. Exhibits negligigle protein tyrosine phosphatase activity at neutral pH. May act as a dominant-negative regulator of UBASH3B- dependent dephosphorylation. May inhibit dynamin-dependent endocytic pathways by functionally sequestering dynamin via its SH3 domain. [The UniProt Consortium] Mouse gene identity: 84% Rat gene identity: 84%