SLC38A2 PrEST Antigen

PrEST Antigen SLC38A2, Gene description: solute carrier family 38 member 2, Alternative Gene Names: ATA2, KIAA1382, SAT2, SNAT2, Antigen sequence: PCPVEAALIINETINTTLTQPTALVPALSHNVTENDSCRPHYFI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Functions as a sodium-dependent amino acid transporter. Mediates the saturable, pH-sensitive and electrogenic cotransport of neutral amino acids and sodium ions with a stoichiometry of 1:1. May function in the transport of amino acids at the blood-brain barrier and in the supply of maternal nutrients to the fetus through the placenta. [The UniProt Consortium] Mouse gene identity: 59% Rat gene identity: 59%