SLC20A1 PrEST Antigen

PrEST Antigen SLC20A1, Gene description: solute carrier family 20 member 1, Alternative Gene Names: Glvr-1, GLVR1, PiT-1, PiT1, Antigen sequence: YTSYCNAVSDLHSASEIDMSVKAEMGLGDRKGSNGSLEEWYDQDKPEVS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Sodium-phosphate symporter which plays a fundamental housekeeping role in phosphate transport, such as absorbing phosphate from interstitial fluid for normal cellular functions such as cellular metabolism, signal transduction, and nucleic acid and lipid synthesis. May play a role in extracellular matrix and cartilage calcification as well as in vascular calcification. [The UniProt Consortium] Mouse gene identity: 94% Rat gene identity: 94%