PWWP3A PrEST Antigen

PrEST Antigen PWWP3A, Gene description: PWWP domain containing 3A, DNA repair factor, Alternative Gene Names: EXPAND1, MUM-1, MUM1, Antigen sequence: PVRKSIQQDVLGTKLPQLSKGSPEEPVVGCPLGQRQPCRKMLPDRSRAARDRANQKLVEYIVKAKGAESHLRAILKSRKPSRW, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Involved in the DNA damage response pathway by contributing to the maintenance of chromatin architecture. Recruited to the vicinity of DNA breaks by TP53BP1 and plays an accessory role to facilitate damage-induced chromatin changes and promoting chromatin relaxation. Required for efficient DNA repair and cell survival following DNA damage. [The UniProt Consortium] Mouse gene identity: 86% Rat gene identity: 86%