PRDX3 PrEST Antigen

PrEST Antigen PRDX3, Gene description: peroxiredoxin 3, Alternative Gene Names: AOP-1, AOP1, MER5, SP-22, Antigen sequence: TKQISRDYGVLLEGSGLALRGLFIIDPNGVIKHLSV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides (PubMed:7733872, PubMed:17707404). Acts synergistically with MAP3K13 to regulate the activation of NF-kappa-B in the cytosol (PubMed:12492477). [The UniProt Consortium] Mouse gene identity: 89% Rat gene identity: 89%