PIR PrEST Antigen

PrEST Antigen PIR, Gene description: pirin, Antigen sequence: SFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFERAKTWKSK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Transcriptional coregulator of NF-kappa-B which facilitates binding of NF-kappa-B proteins to target kappa-B genes in a redox- state-dependent manner. May be required for efficient terminal myeloid maturation of hematopoietic cells. Has quercetin 2,3-dioxygenase activity (in vitro). [The UniProt Consortium] Mouse gene identity: 95% Rat gene identity: 95%