PDCD6IP PrEST Antigen

PDCD6IP PrEST Antigen
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ATA-APrEST96165.100 100 µl

7 - 10 Werktage*

264,00 €
 
PrEST Antigen PDCD6IP, Gene description: programmed cell death 6 interacting protein, Alternative... mehr
Produktinformationen "PDCD6IP PrEST Antigen"
PrEST Antigen PDCD6IP, Gene description: programmed cell death 6 interacting protein, Alternative Gene Names: AIP1, Alix, Hp95, Antigen sequence: GVINEEALSVTELDRVYGGLTTKVQESLKKQEGLLKNIQVSHQEFSKMKQSNNEANLR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Multifunctional protein involved in endocytosis, multivesicular body biogenesis, membrane repair, cytokinesis, apoptosis and maintenance of tight junction integrity. Class E VPS protein involved in concentration and sorting of cargo proteins of the multivesicular body (MVB) for incorporation into intralumenal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome. Binds to the phospholipid lysobisphosphatidic acid (LBPA) which is abundant in MVBs internal membranes. The MVB pathway requires the sequential function of ESCRT-O, -I,-II and -III complexes (PubMed:14739459). The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis (PubMed:17853893, PubMed:17556548). Adapter for a subset of ESCRT-III proteins, such as CHMP4, to function at distinct membranes. Required for completion of cytokinesis (PubMed:17853893, PubMed:17556548, PubMed:18641129). May play a role in the regulation of both apoptosis and cell proliferation. Regulates exosome biogenesis in concert with SDC1/4 and SDCBP (PubMed:22660413). By interacting with F-actin, PARD3 and TJP1 secures the proper assembly and positioning of actomyosin-tight junction complex at the apical sides of adjacent epithelial cells that defines a spatial membrane domain essential for the maintenance of epithelial cell polarity and barrier. [The UniProt Consortium] Mouse gene identity: 97% Rat gene identity: 97%
Schlagworte: AIP1, Hp95, PDCD6IP, PDCD6-interacting protein, ALG-2-interacting protein 1, ALG-2-interacting protein X, Programmed cell death 6-interacting protein
Hersteller: Atlas Antibodies
Hersteller-Nr: APrEST96165

Eigenschaften

Konjugat: No
Wirt: E.coli
Spezies-Reaktivität: human
Format: Solution

Handhabung & Sicherheit

Lagerung: -20°C (avoid repeat freezing and thawing cycles)
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "PDCD6IP PrEST Antigen"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen