paqr8.L&abhd2.S Heterodimer Protein-VLPs, recombinant Xenopus laevis

paqr8.L&abhd2.S Heterodimer Protein-VLPs, recombinant Xenopus laevis
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
CSB-MP4672XBE.20 20 µg - - -

10 - 14 Werktage*

579,00 €
CSB-MP4672XBE.100 100 µg - - -

10 - 14 Werktage*

1.138,00 €
CSB-MP4672XBE.1 1 mg - - -

10 - 14 Werktage*

5.947,00 €
 
Organism: Xenopus laevis (African clawed frog). Source: Mammalian cell. Expression Region: n/a.... mehr
Produktinformationen "paqr8.L&abhd2.S Heterodimer Protein-VLPs, recombinant Xenopus laevis"
Organism: Xenopus laevis (African clawed frog). Source: Mammalian cell. Expression Region: n/a. Protein Length: Heterodimer. Tag Info: C-terminal 6xHis-tagged(This tag can be tested only under denaturing conditions). Target Protein Sequence: MTTAILECIS TLSISFQQLR RLPRFLEGGT TKMPLTVTDS DVPRLFREPY IQTGYRPTDQ DWKYYFLSLF KKHNESVNVW THLLVALAVV LRVVAFVEAG SLSLNVVSFP LYLYVLSSLT YLTCSILAHL LQSKSELAHY TFYFIDYVGV STYQYGCALA HYYYTSNEAW YDKACYFFLP GAAFLGWLSC VGCCYAKYCY KRPYPVMRKI LQVVPAGLAY ILDISPVVHR IVTCHMEDYT DKAVWLHSLQ MIFFIIGAYF FSCPVPEKYF PGSCDFIGHG HQIFHVFLGL CTLSQLEALF IDYQTRQEVF SARYSSNYTL MCCASFFLLI LCSTFTAVYA RRRIKEKLAR KEL&MDAIVETPEMPAVFDGMKLAAVAAFLYIIVRSLNLKNPTAPPDLLYQDTALTRYLIKSCPLLTKEYIPPIIWGKSGHIQTALYGKMGRVSSPHPYGLRKYLTMPDGATATFDLFEPLAEHCTGENVTMVICPGIANHSEKQYIRTFVDYAQKNGYRCAVLNHLGALTNIELTSPRMFTYGCTWEFGAMVNYIRKAFPQTQLIVVGFSLGGNIVCKYLGETASNQERVMCCVSVCQGYSASHAQDTFLQWDQLRRVYNFLMADNMKKIILSHRHILFGDGSKANRVLEDTDLSRLYTATSLMQIDDVVMRKFHGYKTVQEYYEAESCIRYLHNIHVPLMLVNSVDDPLVHDSLLTIPKTLAEKKENVLVVLPLHGGHLGFFEGAVLFPEPLTWMDKLIVQYSNAICQWERNKPQCSDVKQAAESDHK. Purity: The purity information is not available for VLPs proteins. Endotoxin: Not test. Biological Activity: n/a. Form: Lyophilized powder. Buffer: Lyophilized from a 0.2 µm filtered PBS, 6% Trehalose, pH 7.4. Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended.Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant). Relevance: n/a. Reference: n/a. Function: nan
Schlagworte: Putative membrane progesterone receptor, Progestin and adipoQ receptor family member VIII L homeolog
Hersteller: Cusabio
Hersteller-Nr: MP4672XBE

Eigenschaften

Anwendung: Activity not tested
Konjugat: No
Wirt: Mammalian cells
Spezies-Reaktivität: Xenopus laevis (African clawed frog)
MW: 41.9kDa kD
Format: Lyophilized

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "paqr8.L&abhd2.S Heterodimer Protein-VLPs, recombinant Xenopus laevis"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen