PACS1 PrEST Antigen

PACS1 PrEST Antigen
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ATA-APrEST96148.100 100 µl

7 - 10 Werktage*

264,00 €
 
PrEST Antigen PACS1, Gene description: phosphofurin acidic cluster sorting protein 1, Alternative... mehr
Produktinformationen "PACS1 PrEST Antigen"
PrEST Antigen PACS1, Gene description: phosphofurin acidic cluster sorting protein 1, Alternative Gene Names: FLJ10209, KIAA1175, Antigen sequence: GSVDSKYSSSFLDSGWRDLFSRSEPPVSEQLDVAGRVMQYVNGAATTHQLP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Coat protein that is involved in the localization of trans- Golgi network (TGN) membrane proteins that contain acidic cluster sorting motifs. Controls the endosome-to-Golgi trafficking of furin and mannose-6-phosphate receptor by connecting the acidic-cluster- containing cytoplasmic domain of these molecules with the adapter- protein complex-1 (AP-1) of endosomal clathrin-coated membrane pits. Involved in HIV-1 nef-mediated removal of MHC-I from the cell surface to the TGN. [The UniProt Consortium] Mouse gene identity: 88% Rat gene identity: 88%
Schlagworte: PACS1, PACS-1, KIAA1175, Phosphofurin acidic cluster sorting protein 1
Hersteller: Atlas Antibodies
Hersteller-Nr: APrEST96148

Eigenschaften

Konjugat: No
Wirt: E.coli
Spezies-Reaktivität: human
Format: Solution

Handhabung & Sicherheit

Lagerung: -20°C (avoid repeat freezing and thawing cycles)
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "PACS1 PrEST Antigen"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen