OSGEP PrEST Antigen

PrEST Antigen OSGEP, Gene description: O-sialoglycoprotein endopeptidase, Alternative Gene Names: GCPL1, KAE1, OSGEP1, PRSMG1, TCS3, Antigen sequence: YVSGGNTQVIAYSEHRYRIFGETIDIAVGNCLDRFARVLKISNDPSPGYNIEQMAKRGKKLVELPYTVKGMD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. OSGEP likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. [The UniProt Consortium] Mouse gene identity: 99% Rat gene identity: 99%