NPPB PrEST Antigen

PrEST Antigen NPPB, Gene description: natriuretic peptide B, Antigen sequence: LGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSRE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: [Brain natriuretic peptide 32]: Cardiac hormone that plays a key role in mediating cardio-renal homeostasis (PubMed:9458824, PubMed:1672777, PubMed:1914098, PubMed:17372040). May also function as a paracrine antifibrotic factor in the heart. Acts by specifically binding and stimulating NPR1 to produce cGMP, which in turn activates effector proteins that drive various biological responses (PubMed:9458824, PubMed:1672777, PubMed:17372040, PubMed:21098034, PubMed:17349887, PubMed:25339504). Involved in regulating the extracellular fluid volume and maintaining the fluid- electrolyte balance through natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion (PubMed:9458824, PubMed:1914098). Binds the clearance receptor NPR3 (PubMed:16870210). [The UniProt Consortium] Mouse gene identity: 32% Rat gene identity: 32%