NLRC4 PrEST Antigen

NLRC4 PrEST Antigen
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ATA-APrEST96038.100 100 µl

7 - 10 Werktage*

264,00 €
 
PrEST Antigen NLRC4, Gene description: NLR family CARD domain containing 4, Alternative Gene... mehr
Produktinformationen "NLRC4 PrEST Antigen"
PrEST Antigen NLRC4, Gene description: NLR family CARD domain containing 4, Alternative Gene Names: CARD12, CLAN, CLAN1, CLANA, CLANB, CLANC, CLAND, CLR2.1, ipaf, Antigen sequence: RTLEVTLRDFSKLNKQDIRYLGKIFSSATSLRLQIKRCAGVAGSLSLVLSTCKNIYSLMVEASPLTIEDERHITSVTNLKTLSIHDLQNQRLPG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Key component of inflammasomes that indirectly senses specific proteins from pathogenic bacteria and fungi and responds by assembling an inflammasome complex that promotes caspase-1 activation, cytokine production and macrophage pyroptosis (PubMed:15107016). The NLRC4 inflammasome is activated as part of the innate immune response to a range of intracellular bacteria. [The UniProt Consortium] Mouse gene identity: 73% Rat gene identity: 73%
Schlagworte: Ipaf, NLRC4, CARD12, Clan protein, Ice protease-activating factor, CARD, LRR, and NACHT-containing protein, NLR family CARD domain-containing protein 4, Caspase recruitment domain-containing protein 12
Hersteller: Atlas Antibodies
Hersteller-Nr: APrEST96038

Eigenschaften

Konjugat: No
Wirt: E.coli
Spezies-Reaktivität: human
Format: Solution

Handhabung & Sicherheit

Lagerung: -20°C (avoid repeat freezing and thawing cycles)
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "NLRC4 PrEST Antigen"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen