MUC5AC PrEST Antigen

MUC5AC PrEST Antigen
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ATA-APrEST96151.100 100 µl

7 - 10 Werktage*

264,00 €
 
PrEST Antigen MUC5AC, Gene description: mucin 5AC, oligomeric mucus/gel-forming, Alternative Gene... mehr
Produktinformationen "MUC5AC PrEST Antigen"
PrEST Antigen MUC5AC, Gene description: mucin 5AC, oligomeric mucus/gel-forming, Alternative Gene Names: MUC5, Antigen sequence: LLSHNTKLTPMEFGNLQKMDDPTEQCQDPVPEPPRNCSTGFGICEELLHGQLFSGCVALVDVGSYLEACRQDLCFCE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Gel-forming glycoprotein of gastric and respiratory tract epithelia that protects the mucosa from infection and chemical damage by binding to inhaled microorganisms and particles that are subsequently removed by the mucociliary system (PubMed:14535999, PubMed:14718370). Interacts with H.pylori in the gastric epithelium, Barrett's esophagus as well as in gastric metaplasia of the duodenum (GMD) (PubMed:14535999). [The UniProt Consortium] Mouse gene identity: 70% Rat gene identity: 70%
Schlagworte: TBM, MUC-5AC, Mucin-5AC, Gastric mucin, Tracheobronchial mucin, Major airway glycoprotein, Mucin-5 subtype AC, tracheobronchial
Hersteller: Atlas Antibodies
Hersteller-Nr: APrEST96151

Eigenschaften

Konjugat: No
Wirt: E.coli
Spezies-Reaktivität: human
Format: Solution

Handhabung & Sicherheit

Lagerung: -20°C (avoid repeat freezing and thawing cycles)
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "MUC5AC PrEST Antigen"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen