MAF1 PrEST Antigen

MAF1 PrEST Antigen
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ATA-APrEST95968.100 100 µl

7 - 10 Werktage*

264,00 €
 
PrEST Antigen MAF1, Gene description: MAF1 homolog, negative regulator of RNA polymerase III,... mehr
Produktinformationen "MAF1 PrEST Antigen"
PrEST Antigen MAF1, Gene description: MAF1 homolog, negative regulator of RNA polymerase III, Alternative Gene Names: DKFZp586G1123, Antigen sequence: FSAVREDFKDLKPQLWNAVDEEICLAECDIYSYNPDLDSDPFGEDGSLWSFNYFFYNKRLKRIVFFSC, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Plays a role in the repression of RNA polymerase III-mediated transcription in response to changing nutritional, environmental and cellular stress conditions to balance the production of highly abundant tRNAs, 5S rRNA, and other small non-coding RNAs with cell growth and maintenance (PubMed:18377933, PubMed:20233713, PubMed:20516213, PubMed:20543138). Plays also a key role in cell fate determination by promoting mesorderm induction and adipocyte differentiation. Mechanistically, associates with the RNA polymerase III clamp and thereby impairs its recruitment to the complex made of the promoter DNA, TBP and the initiation factor TFIIIB (PubMed:20887893, PubMed:17505538). When nutrients are available and mTOR kinase is active, MAF1 is hyperphosphorylated and RNA polymerase III is engaged in transcription. Stress-induced MAF1 dephosphorylation results in nuclear localization, increased targeting of gene-bound RNA polymerase III and a decrease in the transcriptional readout (PubMed:26941251). Additionally, may also regulate RNA polymerase I and RNA polymerase II- dependent transcription through its ability to regulate expression of the central initiation factor TBP (PubMed:17499043). [The UniProt Consortium] Mouse gene identity: 99% Rat gene identity: 99%
Schlagworte: MAF1, Repressor of RNA polymerase III transcription MAF1 homolog
Hersteller: Atlas Antibodies
Hersteller-Nr: APrEST95968

Eigenschaften

Konjugat: No
Wirt: E.coli
Spezies-Reaktivität: human
Format: Solution

Datenbank Information

UniProt ID : Q9H063 | Passende Produkte
Gene ID : GeneID 84232 | Passende Produkte

Handhabung & Sicherheit

Lagerung: -20°C (avoid repeat freezing and thawing cycles)
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "MAF1 PrEST Antigen"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen