JPH4 PrEST Antigen

PrEST Antigen JPH4, Gene description: junctophilin 4, Alternative Gene Names: JPHL1, KIAA1831, Antigen sequence: PSSPASSRQPWRPPACRSPLPPGGDQGPFSSPKAWPEEWGGAGAQAEELAGYEAEDEAGMQGPGPRDGSPLLGGCSDSSGSLREEE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Junctophilins contribute to the formation of junctional membrane complexes (JMCs) which link the plasma membrane with the endoplasmic or sarcoplasmic reticulum in excitable cells. Provides a structural foundation for functional cross-talk between the cell surface and intracellular calcium release channels. JPH4 is brain- specific and appears to have an active role in certain neurons involved in motor coordination and memory. [The UniProt Consortium] Mouse gene identity: 92% Rat gene identity: 92%