GP6 PrEST Antigen

PrEST Antigen GP6, Gene description: glycoprotein VI platelet, Alternative Gene Names: GPVI, Antigen sequence: ADPEIKRGSGWRPTGCSQPRVMFMTAEPQARSYPREGSWHGRRLKDWRVWSVEAGGQRLQLWKRGHAASSWCSIREPFGQCLSVCLP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Collagen receptor involved in collagen-induced platelet adhesion and activation. Plays a key role in platelet procoagulant activity and subsequent thrombin and fibrin formation. This procoagulant function may contribute to arterial and venous thrombus formation. The signaling pathway involves the FcR gamma-chain, the Src kinases (likely FYN or LYN) and SYK, the adapter protein LAT and leads to the activation of PLCG2. [The UniProt Consortium] Mouse gene identity: 25% Rat gene identity: 25%