FBXL5 PrEST Antigen

PrEST Antigen FBXL5, Gene description: F-box and leucine rich repeat protein 5, Alternative Gene Names: FBL4, FBL5, FLR1, Antigen sequence: VSSKMVRQILELCPNLEHLDLTQTDISDSAFDSWSWLGCCQSLRHLDLSGCEKITDVALEKISRALGILTSHQSGFLKTSTSKITSTAWKNKDITMQSTKQYACLHDLTNKGIGEEIDNEHPWTKPVSSENFTSPYVWMLDAEDLADI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Component of some SCF (SKP1-cullin-F-box) protein ligase complex that plays a central role in iron homeostasis by promoting the ubiquitination and subsequent degradation of IREB2/IRP2. Upon high iron and oxygen level, it specifically recognizes and binds IREB2/IRP2, promoting its ubiquitination and degradation by the proteasome. Promotes ubiquitination and subsequent degradation of DCTN1/p150-glued. [The UniProt Consortium] Mouse gene identity: 88% Rat gene identity: 88%