ESYT2 PrEST Antigen

PrEST Antigen ESYT2, Gene description: extended synaptotagmin 2, Alternative Gene Names: CHR2SYT, FAM62B, KIAA1228, Antigen sequence: DHQHSAQVKRPSVSKEGRKTSIKSHMSGSPGPGGSNTAPSTPVIGGSDKPGMEEKAQPPEAGPQGLHDQGRSSS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Tethers the endoplasmic reticulum to the cell membrane and promotes the formation of appositions between the endoplasmic reticulum and the cell membrane. Binds glycerophospholipids in a barrel-like domain and may play a role in cellular lipid transport. Plays a role in FGF signaling via its role in the rapid internalization of FGFR1 that has been activated by FGF1 binding, this occurs most likely via the AP- 2 complex. Promotes the localization of SACM1L at endoplasmic reticulum-plasma membrane contact sites (EPCS) (PubMed:27044890). [The UniProt Consortium] Mouse gene identity: 77% Rat gene identity: 77%