DYNC1LI2 PrEST Antigen

PrEST Antigen DYNC1LI2, Gene description: dynein cytoplasmic 1 light intermediate chain 2, Alternative Gene Names: DNCLI2, Antigen sequence: PGSPGAGGVQSTAKKSGQKTVLSNVQEELDRMTRKPDSMVTNSSTE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in binding dynein to membranous organelles or chromosomes. [The UniProt Consortium] Mouse gene identity: 98% Rat gene identity: 98%