DND1 PrEST Antigen

PrEST Antigen DND1, Gene description: DND microRNA-mediated repression inhibitor 1, Alternative Gene Names: MGC34750, RBMS4, Antigen sequence: MMTFSGLNRGFAYARYSSRRGAQAAIATLHNHPLRPSCPLLVCRSTEKCELSVDGLPPNLTRSALLLALQPLGPGLQE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: RNA-binding factor that positively regulates gene expression by prohibiting miRNA-mediated gene suppression. Relieves miRNA repression in germline cells. Prohibits the function of several miRNAs by blocking the accessibility of target mRNAs. Sequence- specific RNA-binding factor that binds specifically to U-rich regions (URRs) in the 3' untranslated region (3'-UTR) of several mRNAs. Does not bind to miRNAs. May play a role during primordial germ cell (PGC) survival. However, does not seem to be essential for PGC migration. [The UniProt Consortium] Mouse gene identity: 88% Rat gene identity: 88%