DLG4 PrEST Antigen

PrEST Antigen DLG4, Gene description: discs large MAGUK scaffold protein 4, Alternative Gene Names: PSD-95, PSD95, SAP-90, SAP90, Antigen sequence: KVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKDLLGEEDIPREPRRIVIHR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Postsynaptic scaffolding protein that plays a critical role in synaptogenesis and synaptic plasticity by providing a platform for the postsynaptic clustering of crucial synaptic proteins. Interacts with the cytoplasmic tail of NMDA receptor subunits and shaker-type potassium channels. Required for synaptic plasticity associated with NMDA receptor signaling. Overexpression or depletion of DLG4 changes the ratio of excitatory to inhibitory synapses in hippocampal neurons. May reduce the amplitude of ASIC3 acid-evoked currents by retaining the channel intracellularly. May regulate the intracellular trafficking of ADR1B. Also regulates AMPA-type glutamate receptor (AMPAR) immobilization at postsynaptic density keeping the channels in an activated state in the presence of glutamate and preventing synaptic depression. [The UniProt Consortium] Mouse gene identity: 100% Rat gene identity: 100%