CSAD PrEST Antigen

PrEST Antigen CSAD, Gene description: cysteine sulfinic acid decarboxylase, Alternative Gene Names: CSD, PCAP, Antigen sequence: KECHYSIQKGAAFLGLGTDSVRVVKADERGKMVPEDLERQIGMAEAEGAVP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Catalyzes the decarboxylation of L-aspartate, 3-sulfino-L- alanine (cysteine sulfinic acid), and L-cysteate to beta-alanine, hypotaurine and taurine, respectively. The preferred substrate is 3- sulfino-L-alanine. Does not exhibit any decarboxylation activity toward glutamate. [The UniProt Consortium] Mouse gene identity: 88% Rat gene identity: 88%