CENPJ PrEST Antigen

PrEST Antigen CENPJ, Gene description: centromere protein J, Alternative Gene Names: BM032, CPAP, LAP, LIP1, MCPH6, Sas-4, SASS4, SCKL4, Antigen sequence: SNILSHEQSNFCRTAHGDFVLTSKRASPNLFSEAQYQEAPVEKNNLKEENRNHPTGESILCWEKVTEQIQEANDKNLQKHDDSSEVANIEERPIKAAIG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Plays an important role in cell division and centrosome function by participating in centriole duplication (PubMed:17681131, PubMed:20531387). Inhibits microtubule nucleation from the centrosome. Involved in the regulation of slow processive growth of centriolar microtubules. Acts as microtubule plus-end tracking protein that stabilizes centriolar microtubules and inhibits microtubule polymerization and extension from the distal ends of centrioles (PubMed:15047868, PubMed:27219064, PubMed:27306797). Required for centriole elongation and for STIL-mediated centriole amplification (PubMed:22020124). Required for the recruitment of CEP295 to the proximal end of new-born centrioles at the centriolar microtubule wall during early S phase in a PLK4-dependent manner (PubMed:27185865). May be involved in the control of centriolar-microtubule growth by acting as a regulator of tubulin release (PubMed:27306797). [The UniProt Consortium] Mouse gene identity: 61% Rat gene identity: 61%