CBX6 PrEST Antigen

CBX6 PrEST Antigen
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ATA-APrEST95872.100 100 µl

7 - 10 Werktage*

264,00 €
 
PrEST Antigen CBX6, Gene description: chromobox 6, Antigen sequence:... mehr
Produktinformationen "CBX6 PrEST Antigen"
PrEST Antigen CBX6, Gene description: chromobox 6, Antigen sequence: RSSGSSGCPSPTPQSSDPDDTPPKLLPETVSPSAPSWREPEVLDLSLPPESAATSKRAPPEVTAAAG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development (PubMed:21282530). PcG PRC1 complex acts via chromatin remodeling and modification of histones, it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. Possibly contributes to the target selectivity of the PRC1 complex by binding specific regions of chromatin (PubMed:18927235). Recruitment to chromatin might occur in an H3K27me3- independent fashion. May have a PRC1-independent function in embryonic stem cells. [The UniProt Consortium] Mouse gene identity: 75% Rat gene identity: 75%
Schlagworte: CBX6, Chromobox protein homolog 6
Hersteller: Atlas Antibodies
Hersteller-Nr: APrEST95872

Eigenschaften

Konjugat: No
Wirt: E.coli
Spezies-Reaktivität: human
Format: Solution

Handhabung & Sicherheit

Lagerung: -20°C (avoid repeat freezing and thawing cycles)
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "CBX6 PrEST Antigen"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen