Caspase 8 (CASP8) Recombinant, Human

Recombinant protein corresponding to aa217-384 with two N-terminal Tags, His-Tag and T-7 Tag from human CASP8, expressed in E. coli (Q14790), Amino Acid Sequence: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-SESQ TLDKVYQMKS KPRGYCLIIN NHNFAKAREK VPKLHSIRDR NGTHLDAGAL TTTFEELHFE IKPHDDCTVE QIYEILKIYQ LMDHSNMDCF ICCILSHGDK GIIYGTDGQE APIYELTSQF TGLKCPSLAG KPKVFFIQAC QGDNYQKGIP VETDSEEQPY LEMD, Predicted Molecular Weight: 22.9kD, Predicted Isoelectric Point: 6.0, Subcellular Location: Cytoplasm, Applications: Suitable for use in ELISA, Western Blot, Immunoprecipitation and SDS-PAGE., Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Included Protein Molecular Weight Marker: 168631: Unstained Protein Molecular Weight Marker, 10-70kD. No heating, diluting or reducing agents needed., MW: 10kD, 14kD, 18kD, 22kD, 26kD, 33kD, 44kD, 70kD , Double intensity: 10kD, 18kD, 26kD, Supplied in 62.5mM Tris-H3PO4, pH 7.5, 1mM EDTA, 2% SDS, 100mM DTT, 1mM sodium azide, 0.01% bromo-phenol blue, 33% glycerol. Add 3-5ul/well for mini gels, 7ul/well for large gels. Store at -20°C Stable for 6 months after receipt. Storage and Stability: Lyophilized powder may be stored at -70°C. Stable for 6 months after receipt. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.