C5a, Human, Recombinant

C5a, Human, Recombinant
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
HYC-HC2101-50UG 50 µg -

Fragen Sie uns nach der Lieferzeit

573,00 €
 
Complement fragment C5a is a 74-residu glycopolypeptide which is generated by proteolytic... mehr
Produktinformationen "C5a, Human, Recombinant"
Complement fragment C5a is a 74-residu glycopolypeptide which is generated by proteolytic cleavage of the complement factor C5 in the course of complement activation. C5a is a potent chemoattractant and anaphylatoxin that acts on all classes of leukocytes and on many other cell types including endothelial, smooth muscle, kidney, liver, and neural cells. In addition to its proinflammatory effects, C5a has been shown to protect cells against toxic insult and to stimulate proliferation in neurons and hepatocytes, suggesting a wider role for C5a in homeostasis. C5a is rapidly desarginated by serum carboxypeptidase N to the less potent derivate C5a desArg, the first stage in deactivation of anaphylatoxin activity. The C5a desArg form has a different spectrum of bioactivity to intact C5a. Recombinant human C5a is His-Tagged and has the following amino acid sequence: MRGSHHHHHHGSDYDIPTTENLYFQGGSTLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVA SQLRANISHKDMQLGR
Schlagworte: C5, Complement C5, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4
Hersteller: Hycult Biotech
Hersteller-Nr: HC2101

Eigenschaften

Anwendung: FA, ELISA, WB
Konjugat: No
Wirt: E.coli
Spezies-Reaktivität: human
Format: Lyophilized

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +20°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "C5a, Human, Recombinant"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen