Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
| Artikelnummer | Größe | Datenblatt | Manual | SDB | Lieferzeit | Menge | Preis |
|---|---|---|---|---|---|---|---|
| HYC-HC2140-50UG | 50 µg | - | - |
5 - 10 Werktage* |
361,00 €
|
Bei Fragen nutzen Sie gerne unser Kontaktformular.
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
Antimicrobial proteins (AMP) are a fundamental element of the primary response against pathogens.... mehr
Produktinformationen "Beta-defensin 2, Human, Peptide"
Antimicrobial proteins (AMP) are a fundamental element of the primary response against pathogens. AMP's are small endogenous cationic molecules expressed by phagocytic and epithelial cells. The antimicrobial activity of AMP's is directed towards a broad spectrum of pathogens, like Gram-positive and -negative bacteria, viruses, yeast and fungi. AMP's aid in innate immunity and adaptive immunity via direct inactivation and by immunomodulatory activity like leukocyte migration. Defensins are the most prominent mammalian AMP's. Three defensin peptide families are identified, the alpha-, beta-, and theta-defensins. They are characterized by a triple-stranded beta-hairpin structure, six disulfide-linked cysteine residues and a positive charge. They are synthesized as preproteins and undergo processing to become a fully active peptide. Defensins are divided in alpha- and beta-defensins depending on their disulfide bridging pattern. Human beta-defensin-2 (hBD-2) is a cystein-rich cationic 41 amino acid antimicrobial peptide of 4-5 kDa. hBDs are localized in epithelial surfaces. Originally, hBD2 was identified in psoriatic scales. Nowadays, hBD-2 has been described as a dynamic component of the local epithelial defense system of the skin, intestinal and respiratory tract, where it functions by protecting surfaces from infection. The hBD2 gene is flanked by several binding sites of NF-kB. Its expression is inducible by proinflammatory molecules like TNFalpha, IL1alpha, diverse panel of bacteria, yeasts, IL22 and most of all by IL-17. hBD2 functions best under low ionic strength conditions and is weakened at high salt concentrations. hBD is capable of forming dimers and its microbial activity derives from the mechanism to permeabilize the anionic lipid bilayer, to form pores and the subsequent release of cellular content. HC2140 is a synthetic peptide and has the following sequence: H-GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP-OH.
| Schlagworte: | DEFB4B, DEFB4A, Beta-defensin 2, Defensin beta 4A, Defensin, beta 2, Skin-antimicrobial peptide 1 |
| Hersteller: | Hycult Biotech |
| Hersteller-Nr: | HC2140 |
Eigenschaften
| Anwendung: | FA, WB |
| Konjugat: | No |
| Spezies-Reaktivität: | human |
| Format: | Lyophilized |
Datenbank Information
| KEGG ID : | K21100 | Passende Produkte |
| UniProt ID : | O15263 | Passende Produkte |
| Gene ID : | GeneID 100289462 | Passende Produkte |
Handhabung & Sicherheit
| Lagerung: | -20°C |
| Versand: | +20°C (International: °C) |
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
Loggen Sie sich ein oder registrieren Sie sich, um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Beta-defensin 2, Human, Peptide"
Bewertung schreiben
Loggen Sie sich ein oder registrieren Sie sich, um eine Produktbewertung abzugeben.
Zuletzt angesehen