- Search results for GeneID 220047
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
7 products were found matching "GeneID 220047"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA075087.100
Polyclonal Antibody against Human CCDC83, Gene description: coiled-coil domain containing 83, Alternative Gene Names: CT148, FLJ42119, KP-CoT-23, MGC34732, Validated applications: ICC, Uniprot ID: Q8IWF9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity:...
| Keywords: | Anti-HSD9, Anti-CCDC83, Anti-Coiled-coil domain-containing protein 83 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: ABS-PP-8607-L.100
| Keywords: | Coiled-coil domain-containing protein 83, Recombinant Human CCDC83 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 47.5 kD |
From 115.00€
*
Item number: ABS-PP-8608-L.100
| Keywords: | Coiled-coil domain-containing protein 83, Recombinant Human CCDC83 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 45 kD |
From 115.00€
*
Item number: CSB-CL818244HU.10
Length: 1242 Sequence: atggaaaact cagggaaagc aaataaaaag gatacacatg acgggccacc aaaagaaatt aaactgccta ccagtgaagc acttctagac tatcaatgtc aaataaagga agatgccgtg gagcaattca tgtttcaaat aaagacactt aggaaaaaga accaaaaata tcatgaaaga aatagccgct taaaagaaga acagatttgg cacatacggc atctactaaa ggaactgagt gaagagaagg cagagggatt...
| Keywords: | HSD9, CCDC83, Coiled-coil domain-containing protein 83 |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
460.00€
*
Item number: ABS-PP-8607.100
| Keywords: | Coiled-coil domain-containing protein 83, Recombinant Human CCDC83 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 47.5 kD |
From 90.00€
*
Item number: ABS-PP-8608.100
| Keywords: | Coiled-coil domain-containing protein 83, Recombinant Human CCDC83 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 45 kD |
From 90.00€
*
Item number: ATA-APrEST96147.100
PrEST Antigen CCDC83, Gene description: coiled-coil domain containing 83, Alternative Gene Names: CT148, FLJ42119, KP-CoT-23, MGC34732, Antigen sequence: AKLITSLQNDINTVKENAEKMSEHYKITLEDTRKKIIKETLLQLDQKKEWATQNAVKLIDKGSYLEIWENDWLKKEVAIHRKEVEEL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles....
| Keywords: | HSD9, CCDC83, Coiled-coil domain-containing protein 83 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*