PPBP, Recombinant, Human, aa59-125, GST-Tag (Platelet Basic Protein)

PPBP, Recombinant, Human, aa59-125, GST-Tag (Platelet Basic Protein)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
374810.10 10 µg - -

3 - 19 business days*

354.00€
374810.50 50 µg - -

3 - 19 business days*

472.00€
374810.100 100 µg - -

3 - 19 business days*

658.00€
374810.200 200 µg - -

3 - 19 business days*

906.00€
 
LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation,... more
Product information "PPBP, Recombinant, Human, aa59-125, GST-Tag (Platelet Basic Protein)"
LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. NAP-2 is a ligand for CXCR1 and CXCR2, and NAP-2, NAP-2(73), NAP-2(74), NAP-2(1-66), and most potent NAP-2(1-63) are chemoattractants and activators for neutrophils. TC-1 and TC-2 are antibacterial proteins, in vitro released from activated platelet alpha-granules. CTAP-III(1-81) is more potent than CTAP-III desensitize chemokine-induced neutrophil activation. Source: Recombinant protein corresponding to aa59-125 from human PPBP, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~34.4kD, AA Sequence: AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: PPBP, CTAP3
Supplier: United States Biological
Supplier-Nr: 374810

Properties

Conjugate: No
MW: 34,4
Format: Highly Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow. more
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "PPBP, Recombinant, Human, aa59-125, GST-Tag (Platelet Basic Protein)"
Write a review
or to review a product.
Viewed